PRGDB00071142 (Mtr.586)

From PRG Wiki
Jump to: navigation, search
Mtr.586
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30099175 (CB892007)
Gene Class Unknown
Domain Type LRR
Gene Species Medicago truncatula

Comment?

EST648976 KV3 Medicago truncatula cDNA clone KV3-52J20, mRNA sequence

DNA Sequence

AAGGTAGAAAAATCACACCAAATTCTAGGATTTTCAGTTTTTGCTGCAAAAAGTTCTTTGAACTTTGTTGCTTAGATTGAAGCTGCTGAATTGACAAGGAAGAAGGAACAATTAATAGAGTGTAGAAAAAAATGAAGTTGTGTACTTCATTGTTGTTTATGGGTTTGGTTTCTATGCTTTCTTTTGTGGCCTCTGCTATGGTGGTATCAAATGAAGTTGGGGCGCTTTCAACCTTCAAAGAAGCTGTTTATGAAGATCCACATATGGTTTTGTCAAATTGGAATACTTTAGATTCAGATCCTTGTGACTGGAATGGAGTTTCATGCACCGGAACTCGAGATCATGTCATCAAGCTAAACATATCAGGGGCATTACTAAGAGGGTTTCTTGCTCCAGAAATCGGGAAAATAACCTACTTGCAAGAACTAATATTGCATGGCAACAATCTCATTGGAACAATACCGAAAGAATTGAGCGCATTAAAATCTCTTAAGGTGTTGGATTTGGGAAAGAATCAGTTATCTGGACCAATTCCTCGAGAGATTGGAAATTTGACACAAATTGTAAAAATAAATCTGCAGTCCAATGGTTTGACTGGTAGATTGCCTTCAGAGCTTGCAAATTTGAAATATCTTCAAGAACTTCGGCTTGATAGGAATAAGCTTGAAGGGCCTGTTCCTGCTGCTAGCACTT


Protein sequences

Name Description Sequence
Mtr.586 translated coding region predicted by ESTScan from UniGene Mtr.586

MKLCTSLLFMGLVSMLSFVASAMVVSNEVGALSTFKEAVYEDPHMVLSNWNTLDSDPCDWNGVSCTGTRDHVIKLNISGALLRGFLAPEIGKITYLQELILHGNNLIGTIPKELSALKSLKVLDLGKNQLSGPIPREIGNLTQIVKINLQSNGLTGRLPSELANLKYLQELRLDRNKLEGPVPAASTX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF812
3-180 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

LCTSLLFMGLVSMLSFVASAMVVSNEVGALSTFKEAVYEDPHMVLSNWNTLDSDPCDWNGVSCTGTRDHVIKLNISGALLRGFLAPEIGKITYLQELILHGNNLIGTIPKELSALKSLKVLDLGKNQLSGPIPREIGNLTQIVKINLQSNGLTGRLPSELANLKYLQELRLDRNKLEG

HMMPanther: PTHR24420
3-180 FAMILY NOT NAMED,FAMILY NOT NAMED

LCTSLLFMGLVSMLSFVASAMVVSNEVGALSTFKEAVYEDPHMVLSNWNTLDSDPCDWNGVSCTGTRDHVIKLNISGALLRGFLAPEIGKITYLQELILHGNNLIGTIPKELSALKSLKVLDLGKNQLSGPIPREIGNLTQIVKINLQSNGLTGRLPSELANLKYLQELRLDRNKLEG

superfamily: SSF52058
22-183 L domain-like,LRR

AMVVSNEVGALSTFKEAVYEDPHMVLSNWNTLDSDPCDWNGVSCTGTRDHVIKLNISGALLRGFLAPEIGKITYLQELILHGNNLIGTIPKELSALKSLKVLDLGKNQLSGPIPREIGNLTQIVKINLQSNGLTGRLPSELANLKYLQELRLDRNKLEGPVP

HMMPfam: PF08263
IPR013210
27-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NEVGALSTFKEAVYEDPHMVLSNWNTLDSDPCDWNGVSC

Gene3D: G3DSA:3.80.10.10
29-184 no description

VGALSTFKEAVYEDPHMVLSNWNTLDSDPCDWNGVSCTGTRDHVIKLNISGALLRGFLAPEIGKITYLQELILHGNNLIGTIPKELSALKSLKVLDLGKNQLSGPIPREIGNLTQIVKINLQSNGLTGRLPSELANLKYLQELRLDRNKLEGPVPA

HMMPfam: PF12799
94-131 LRR_4,Leucine Rich repeats (2 copies)

TYLQELILHGNNLIGTIPKELSALKSLKVLDLGKNQLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox