PRGDB00071143 (Mtr.613)

From PRG Wiki
Jump to: navigation, search
Mtr.613
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 11902048 (BF637890)
Gene Class Unknown
Domain Type
Gene Species Medicago truncatula

Comment?

NF027H08PL1F1074 Phosphate starved leaf Medicago truncatula cDNA clone NF027H08PL 5', mRNA sequence

DNA Sequence

GCACCAGttttttttttACAACAAATTTGGTTACTTGCACCTTTCATATTGTTGTAAGTTGTTGGTCATACATAATATCTTTCTTGTCCATAATGATAACATCATCACTAAAaaacttatactaaaatcatatcatactaaatttttatacacattttttaattaattaattaaaaCTTGTACACCACATTTTCAAATGCCTCATCATCAAATTTGTTGTCCCatttttctttttgggatttttAATATACATGACTCTTGAACTTGAATTTGATAACTGATTCTTTCAAAATCTTCACTCACTGTTCTGGGAGATAACTTCTCCAAACTTGAGAAAGAGTTGAGCATCTGAAGTGCTCATGGAAGGACAGTTGACCAAATGAGGAGTCTTGAGATTTGCATACTCATCCATGTAGCATGGAACTTTGGCAGATGGATGAGATGCCGGCTGTANAGGAGTTAGTTGTTTCGCGGGAGCGACTGACGGCATGAGACTTCCTAATACACGTGAAACTTCATGCATCGNTGGTCTATCGGCTGGCTGCCTCTTTGTGCATAATAGAGCAAGCTGAAAAACTTTCTTTACTGCTCCTANGTCCTTGCATGTGGCAGTTACCGTCGGGATCAACCGNTTCCATTACTGCATTGCTAGCTGGCTTGGACAAAATTANATGATGGAGG


Protein sequences

Name Description Sequence
Mtr.613 translated coding region predicted by ESTScan from UniGene Mtr.613

XLHHXILSKPASNAVMEXVDPDGNCHMQGXGAVKKVFQLALLCTKRQPADRPXMHEVSRVLGSLMPSVAPAKQLTPXQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF825
2-128 SUBFAMILY NOT NAMED

LHHXILSKPASNAVMEXVDPDGNCHMQGXGAVKKVFQLALLCTKRQPADRPXMHEVSRVLGSLMPSVAPAKQLTPXQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE

HMMPanther: PTHR24420
2-128 FAMILY NOT NAMED,FAMILY NOT NAMED

LHHXILSKPASNAVMEXVDPDGNCHMQGXGAVKKVFQLALLCTKRQPADRPXMHEVSRVLGSLMPSVAPAKQLTPXQPASHPSAKVPCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox