PRGDB00071171 (Mtr.3724)

From PRG Wiki
Jump to: navigation, search
Mtr.3724
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83665121 (DW015529)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

EST1224490 MTY Medicago truncatula cDNA clone MTYA639, mRNA sequence

DNA Sequence

attaaattattaacattattatttcattccctaaattaccatattattttcattaatttcgtcataaaaaaaaaaaaaaaaaGAGTGTGTTCATTTGATCTAATCATCATCGAGAGAGGGGAAATGCTAGATAGCTCCTCTCTCTGTGTGACCAAATATACAGATCttattttttattttaacaattttttaatttaatttaATTCAACTCTCTCTGTGAAAGAGATGAGTTGTTATTCTTGCTTTGTTTCTCGGAAAAAAGATGTTAGCAGAATTGAAGTTGATAATAGTTCTCGATCTGCTCATACTTTAGGGAATGGAGGAACAAATGCAACAGAGGAAAAGGGGAAGAGTGTGAGGACTGGTAAAAGCAGTACTGCAGCAGCTAGTTTTGGTTCTAGAGAGCTTGCGACAGCGACCAGGGGTTTTAAGGAAGCTAATTTGATTGGAGAAGGAGGTTTTGGAAAAGTATTTAAGGGTCGTCTTTCGACCGGCGAGCTTGTTGCTGTGAAACAATTAAGTCATGATGGTCGTCAAGGTTTTCAGGAATTTGTGACTGAGGTTCTTATGTTAAGCTTGCTACATCATTCTAATCTGGTTAAGTTAATTGGCTACTGCACTGATGGAGATCAAAGGCTTTTGGTTTATGAGTACATGCCTATGGGATCTCTCGAAGATCATCTTTTTGATCTTCCCCAAGACAAAGAACCTCTAAGCTGGAGTTCTCGAATGAAGATTGCTGTTGGAGCAGCTCGTGGCCTTGAGTATCTCCACTGTAAAGCAGATCCGCCTGTCATATATCGAGACTTAAAATCTGCAAACATCTTATTAGACAGCGACTTCAGCCCAAACTGTCAGATTTTGGGCTTGCTAAGCTAGGACCTGTTGGAGACACACCCATGTTT


Protein sequences

Name Description Sequence
Mtr.3724 translated coding region predicted by ESTScan from UniGene Mtr.3724

MSCYSCFVSRKKDVSRIEVDNSSRSAHTLGNGGTNATEEKGKSVRTGKSSTAAASFGSRELATATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGDTPMF

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
51-129 no description

TAAASFGSRELATATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIG

HMMPanther: PTHR24420:SF657
53-223 SUBFAMILY NOT NAMED

AASFGSRELATATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGD

HMMPanther: PTHR24420
53-223 FAMILY NOT NAMED,FAMILY NOT NAMED

AASFGSRELATATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGD

superfamily: SSF56112
IPR011009
57-224 Protein kinase-like (PK-like)
Protein kinase-like domain

GSRELATATRGFKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGDT

ProfileScan: PS50011
IPR000719
68-227 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGDTPMF

HMMSmart: SM00219
IPR020635
68-227 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGDTPMF

HMMSmart: SM00220
IPR002290
68-227 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FKEANLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKLGPVGDTPMF

HMMPfam: PF07714
IPR001245
72-217 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NLIGEGGFGKVFKGRLSTGELVAVKQLSHDGRQGFQEFVTEVLMLSLLHHSNLVKLIGYCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAK

PatternScan: PS00107
IPR017441
74-96 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGKVFKGRLSTGELVAVK

Gene3D: G3DSA:1.10.510.10
130-218 no description

YCTDGDQRLLVYEYMPMGSLEDHLFDLPQDKEPLSWSSRMKIAVGAARGLEYLHCKADPPXHISRLKICKHLIRQRLQPKLSDFGLAKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox