PRGDB00071175 (Mtr.3840)

From PRG Wiki
Jump to: navigation, search
Mtr.3840
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83665301 (DW015709)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

EST1224670 MTY Medicago truncatula cDNA clone MTYA869, mRNA sequence

DNA Sequence

CGGCCGGGGGACCCTTTCTTCTTCTTTCTAAGATCCTTCTCATCAAAACTTCAATAAACAATAAAAAAAAGGTGtttttattttattttattttcttcttatttttttgtttctacccttttGTACCCATTTCATGAATTTTACTTGCATGATTGCATCTGAAAAAGCCTTAAACTTTTATCAGTGATTTTGTTTGATGGGTGCTTGTTGGAGTAATAAGGTTAAGTCTGTGAGTCCTTCAAACACAGGGTTCACTTCAAGAAGTGTAAGCAGAAGTGGCCATGACATCAGCTCAACTAGCAGGAACTCATCAGCCTCTATATCGGTCACTTCTCGAAGTGAGGGAGAAATCTTGCAATCTTCCAACTTGAAAAGCTTCAGCTACAATGAAGTAAGAGCGGCTACGAGAAATTTCCGGCCGGACAGTGTCTTGGGGGAAGGTGGTTTTGGTTCAGTTTTTAAAGGCTGGATTGACGAGCATTCACATGCTGCAACCAAACCAGGAATGGGTATTATTGTTGCTGTGAAGAGGCTTAACCAAGAAGGGCATCAGGGTCATAGAGAATGGTTGGCTGAAATCAACTATCTCGGGCAACTTCAGCATCCTAATCTCGTCAAATTAATAGGATACTGCTTTGAGGATGAACATCGGCTCCTGGTTTATGAGTTTATGCCAAAGGGAAGCATGGAAAATCATCTATTTCGACGAGGTTCTTATTTTCAACCATTCTCTTGGAGTTTGCGAATGAAAATTGCCCTCGGAGCTGCAAAAGGCCTTGCTTTTCTCCATAGTACAGAACCTAAAGTCATATACCGTGACTTCAAACTTCGAATATACTGCTCGATTCTAACTATGGTGCTAAACTTTCTGATTTTGGGTTGGCAGAGATGGACCAACTGGTGATAAAGTCATGTCTCAACT


Protein sequences

Name Description Sequence
Mtr.3840 translated coding region predicted by ESTScan from UniGene Mtr.3840

MGACWSNKVKSVSPSNTGFTSRSVSRSGHDISSTSRNSSASISVTSRSEGEILQSSNLKSFSYNEVRAATRNFRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLAEMDQLVIKSCLNX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF861
18-230 SUBFAMILY NOT NAMED

GFTSRSVSRSGHDISSTSRNSSASISVTSRSEGEILQSSNLKSFSYNEVRAATRNFRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLA

HMMPanther: PTHR24420
18-230 FAMILY NOT NAMED,FAMILY NOT NAMED

GFTSRSVSRSGHDISSTSRNSSASISVTSRSEGEILQSSNLKSFSYNEVRAATRNFRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLA

Seg: seg
31-48 seg

ISSTSRNSSASISVTSRS

superfamily: SSF56112
IPR011009
45-230 Protein kinase-like (PK-like)
Protein kinase-like domain

TSRSEGEILQSSNLKSFSYNEVRAATRNFRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLA

Gene3D: G3DSA:3.30.200.20
54-145 no description

QSSNLKSFSYNEVRAATRNFRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGY

ProfileScan: PS50011
IPR000719
73-243 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLAEMDQLVIKSCLNX

HMMSmart: SM00219
IPR020635
73-243 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLAEMDQLVIKSCLNX

HMMSmart: SM00220
IPR002290
73-243 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDSVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLAEMDQLVIKSCLNX

HMMPfam: PF07714
IPR001245
77-232 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SVLGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVKRLNQEGHQGHREWLAEINYLGQLQHPNLVKLIGYCFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLAEM

PatternScan: PS00107
IPR017441
79-111 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGSVFKGWIDEHSHAATKPGMGIIVAVK

Gene3D: G3DSA:1.10.510.10
146-231 no description

CFEDEHRLLVYEFMPKGSMENHLFRRGSYFQPFSWSLRMKIALGAAKGLAFLHSTEPKVIYRDFKLXNILLDSNYGAKLSDFGLAE

PatternScan: PS00108
IPR008271
204-216 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKLXNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox