PRGDB00071176 (Mtr.3866)

From PRG Wiki
Jump to: navigation, search
Mtr.3866
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 20273925 (BQ137799)
Gene Class Unknown
Domain Type
Gene Species Medicago truncatula

Comment?

NF012A11RT1F1084 Developing root Medicago truncatula cDNA clone NF012A11RT 5', mRNA sequence

DNA Sequence

ctgatacgccagctcgaaattaaccctcactaaagggaacaaaagctggagctccaccgcggtggcggccgctctagaactagtggatcccccgggctgcaggaattcggcacgaggcTGAAGCTCTGGAAACACAAGTTAAAAGCAAGGTCTCTATCAAGGGACATCTGCATACATACAGATTTTGTGACAATGTTTGGACCTTCATCTTACAAGATGCTTTGTTTAAGAATGAAGACAACCAAGAGAATGTTGGACGGGTTAAAATAGTGGCATGTGACTCGAAATTGCTCAGTCAGTAATATGCTCAATTTCTATCGTATTGTCAACGAGGAGCTTATCATCTGCTGGTACCATGGATTGGTGGTTAGACCATAGTGACGGATGTGGCCTTCAGTTCTTGCAGGAACCAGCATCTACACTATGTTATTATAGATTTAAAAGGCCTTCAATCTTCATGTTATTATTATGTAATTCATGTTACATTGAGAATATCACTTGGGAACTGGATGAATCTATTATTTAACTGTATTGATTTCTATTTGACCaaaaaaaaaaCTGTACTCTGTTCTATTCTTCCATGAGCTCTATGTAAACAAATTTATaaaaaaaaaaagaaaaagaaaaaGGGCCTCAGAGGGGGGGCCCGGTCACCCAATTCCCCCTATAGTGGAGTCCGTTATTACAATTTCCACTGGCCGGTCGTGTTTTAAAACCGTTCGGTGgactgggaaaaccctggcgttaacccaactttaatcggcttggcaagcacagttccccttttctgccaggctg


Protein sequences

Name Description Sequence
Mtr.3866 translated coding region predicted by ESTScan from UniGene Mtr.3866

XXYASSKLTLTKGNKSWSSTAVAAALELVDPPGCRNSAEAEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSKLLSQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10966
IPR003194
41-100 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

EALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSKLLSQ

superfamily: SSF50784
IPR009088
46-96 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSK

HMMPfam: PF02751
IPR015871
46-95 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDS

Gene3D: G3DSA:2.30.18.10
IPR009088
49-98 no description
Transcription factor IIA, beta-barrel

SKVSIKGHLHTYRFCDNVWTFILQDALFKNEDNQENVGRVKIVACDSKLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox