PRGDB00071196 (Mtr.5965)

From PRG Wiki
Jump to: navigation, search
Mtr.5965
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18700700 (AF458699)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

Medicago truncatula ankyrin-kinase mRNA, complete cds

DNA Sequence

CGGCACGAGGTTTCTTCGCTGTATTCTCATTCCCATGCCTCGTTTCATCGAGAGATTCCTCCGTCGTTAGATTTGGATCTCTCCACCATGGAAAACATTGCCGCGCAACTAAAGCGCGGCATCTCGCGCCAATTCTCCTCCGGCTCTTTACGCAAAACTCTCAGCCGTCAATTCACACGTCAAGCATCGCTCGATCCACGTCGGAACAATCTCCGATTCAGCTTCGGTCGTCAATCATCGCTGGACCCGATCCGACGGAGTCCAGGTGATGATGAAGACCAGGCGGAACTCACCGTACCGGAGAATCTCGATTCCACCATGCAGCTTCTCTTCATGGCGTGTCGTGGTGATGTTAAAGGGGTTGAGGATTTGCTTAACGAAGGAATTGATGTTAATAGCATTGATCTTGATGGCCGTACTGCTCTTCATATCGCTGCTTGTGAAGGACATGTTGATGTTGCGAAGCTTTTGCTCAGCCGTAAGGCCAACCTTGATGCTCGTGATCGTTGGGGTAGTACGGCAGCGGCTGATGCTAAATATTATGGAAATACAGAAGTTTATTATATGTTGAAGGCACGTGGAGCAAAAGTGCCGAAAACCAGGAAGACTCCAATGACTGTTGCAAATCCTCGTGAAGTTCCTGAATATGAACTCAATCCGTTAGAACTACAGGTTCGGAAGAGTGATGGTATTTCAACGGGGACATATCAAGTAGCTAAATGGAATGGCACAAAGGTTGCGGTGAAGATACTTGATAAGGACAGTTATTCAGATCCTGATACCATAAATATTTTCAAACACGAGCTCACACTATTGGAAAAGGTGCGTCATCCTAATGTGGTCCAGTTTGTTGGAGCTGTCACCCAAAACATACCTATGATGATTGTTCGAGAGTACCATGCTAAGGGTGACTTAACAGGTTATATTCAAAAGAAAGGGCGTTTGTCCCCATCAAAAGTTCTACGGTTTTCTCTTGATATTGCTAGGGGCATGAATTATCTTCATGAATGCAAGCCAGATCCTATTATCCACTGTGATTTAAAGCCAAAAAATATTTTGCTGGATAATGGAGGTCAACTGAAGGTAGCTGGATTTGGCACTGTGAGATTTTCACTAATAACACCTGACAAAGCATTGTTAGAACAGCCTGAGGCCAACATTGACCCTTCAAGCTTGTACGTGGCACCGGAGATTTACAGAGGTGATGTATTTGATAGAAGTGTGGATGCGTATTCTTTTGGTCTCATTGTATATGAGATGATAGAGGGTATACCGCCCTTCCATCCCAAGCCCGCAGAGGAAGCTTTGAAACTGATGTGTTTAGAAGGGAAGAGACCGCAATTCAAGATCAAAACAAAGAGTTATCCTCCGGATTTGAAAGAGTTGATTGAGGAATGCTGGGATCCAGAACCTGAGGTCAGACCAACATTTTCTCAGGTCATTGCCCGGTTGGACAAAATTGTTGCGAATTGCTCAAAACAAGGATGGTGGAAAGATGCTTTTAAACTTCCCTGGAAATAAATAAGACGGTCATCAGAGCAAGCAGTAGATATCGATCAGAGTTGTATCATCAAAACTGATTTGTGAGCCCCATGGTGTTGTAATGTTAATAGCCATTGCAATTAATAACTTCCGAACTCGAATAGTACGAGCTTGAGTTTGGATTTGAGCCCAAAAATGAATTCCCACAGCTCCAATGCTGTTTTCTGTATATTAGAGGTCTGAAAAACCCTCTCTGTAAAATGTATCATAACCCACACACATTTTAGAACATCTATTTTGAGAAATTTTCTAATAAACGGTATGTTTTCCGCAGTTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Mtr.5965 translated coding region predicted by ESTScan from UniGene Mtr.5965

RHEVSSLYSHSHASFHREIPPSLDLDLSTMENIAAQLKRGISRQFSSGSLRKTLSRQFTRQASLDPRRNNLRFSFGRQSSLDPIRRSPGDDEDQAELTVPENLDSTMQLLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKVPKTRKTPMTVANPREVPEYELNPLELQVRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIVANCSKQGWWKDAFKLPW

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF000654
IPR016253
30-505 Integrin-linked protein kinase
Integrin-linked protein kinase

MENIAAQLKRGISRQFSSGSLRKTLSRQFTRQASLDPRRNNLRFSFGRQSSLDPIRRSPGDDEDQAELTVPENLDSTMQLLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKVPKTRKTPMTVANPREVPEYELNPLELQVRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIVANCSKQGWWKDAFKLPW

HMMPanther: PTHR23257:SF89
67-505 ANKYRIN-KINASE,ANKYRIN-KINASE

RRNNLRFSFGRQSSLDPIRRSPGDDEDQAELTVPENLDSTMQLLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKVPKTRKTPMTVANPREVPEYELNPLELQVRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIVANCSKQGWWKDAFKLPW

HMMPanther: PTHR23257
67-505 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

RRNNLRFSFGRQSSLDPIRRSPGDDEDQAELTVPENLDSTMQLLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKVPKTRKTPMTVANPREVPEYELNPLELQVRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIVANCSKQGWWKDAFKLPW

ProfileScan: PS50297
IPR020683
104-202 ANK_REP_REGION
Ankyrin repeat-containing domain

DSTMQLLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKVPKTRK

HMMSmart: SM00248
IPR002110
105-133 ankyrin repeats
Ankyrin repeat

STMQLLFMACRGDVKGVEDLLNEGIDVNS

superfamily: SSF48403
IPR020683
109-197 Ankyrin repeat
Ankyrin repeat-containing domain

LLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKV

Gene3D: G3DSA:1.25.40.20
IPR020683
109-207 no description
Ankyrin repeat-containing domain

LLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKVPKTRKTPMTV

HMMPfam: PF12796
IPR020683
109-197 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

LLFMACRGDVKGVEDLLNEGIDVNSIDLDGRTALHIAACEGHVDVAKLLLSRKANLDARDRWGSTAAADAKYYGNTEVYYMLKARGAKV

ProfileScan: PS50088
IPR002110
137-169 ANK_REPEAT
Ankyrin repeat

DGRTALHIAACEGHVDVAKLLLSRKANLDARDR

HMMSmart: SM00248
IPR002110
137-166 ankyrin repeats
Ankyrin repeat

DGRTALHIAACEGHVDVAKLLLSRKANLDA

superfamily: SSF56112
IPR011009
195-484 Protein kinase-like (PK-like)
Protein kinase-like domain

AKVPKTRKTPMTVANPREVPEYELNPLELQVRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARL

ProfileScan: PS50011
IPR000719
221-488 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LELQVRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIV

HMMSmart: SM00220
IPR002290
225-488 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARLDKIV

HMMSmart: SM00219
IPR020635
225-484 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VRKSDGISTGTYQVAKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIARL

Gene3D: G3DSA:3.30.200.20
239-285 no description

AKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVG

HMMPfam: PF00069
IPR017442
239-481 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

AKWNGTKVAVKILDKDSYSDPDTINIFKHELTLLEKVRHPNVVQFVGAVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVI

Gene3D: G3DSA:1.10.510.10
286-482 no description

AVTQNIPMMIVREYHAKGDLTGYIQKKGRLSPSKVLRFSLDIARGMNYLHECKPDPIIHCDLKPKNILLDNGGQLKVAGFGTVRFSLITPDKALLEQPEANIDPSSLYVAPEIYRGDVFDRSVDAYSFGLIVYEMIEGIPPFHPKPAEEALKLMCLEGKRPQFKIKTKSYPPDLKELIEECWDPEPEVRPTFSQVIA

PatternScan: PS00108
IPR008271
342-354 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDLKPKNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox