PRGDB00071198 (Mtr.6064)

From PRG Wiki
Jump to: navigation, search
Mtr.6064
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 27966031 (AY184243)
Gene Class Unknown
Domain Type
Gene Species Medicago truncatula

Comment?

Medicago truncatula anthocyanidin reductase (BAN) mRNA, complete cds

DNA Sequence

AAAGAGAGTGTGTAAATTAACATTTGATGGCTAGTATCAAACAAATAGAAATAGAAAAGAAGAAGGCATGTGTGATAGGTGGCACTGGTTTTGTGGCATCATTGCTGATCAAGCAGTTGCTTGAAAAGGGTTATGCTGTTAATACTACTGTTAGAGACCTAGATAGTGCAAACAAAACATCTCACCTCATAGCACTGCAAAGTTTGGGGGAACTGAATCTATTTAAAGCAGAATTAACAATTGAAGAAGATTTTGATGCTCCTATATCAGGATGTGAACTTGTCTTCCAACTTGCTACACCTGTGAACTTTGCTTCTCAAGATCCTGAGAATGACATGATAAAACCAGCAATCAAAGGTGTATTGAATGTGTTGAAAGCATGTGTAAGAGCAAAAGAAGTCAAAAGAGTTATCTTAACATCTTCAGCAGCTGCTGTGACTATAAACGAACTCGAAGGGACTGGTCATGTTATGGATGAAACCAATTGGTCTGATGTTGAGTTTTTGAACACTGCAAAGCCACCCACTTGGGGTTATCCTGTTTCAAAAGTACTAGCTGAAAAGGCTGCGTGGAAATTTGCTGAAGAAAATAACATTGATCTAATCACTGTGATACCTACTCTAACAATTGGTCCTTCTCTAACTCAAGATATCCCATCTAGTGTTGCCATGGGAATGTCACTTCTAACAGGCAATGATTTCCTCATAAATGCTTTGAAAGGAATGCAGTTTCTATCGGGTTCAATATCAATTACTCATGTCGAGGATATTTGTCGGGCTCATATTTTTGTGGCAGAGAAAGAATCAACTTCTGGTCGATACATTTGCTGTGCTCACAATACCAGTGTTCCCGAGCTTGCAAAGTTTCTCAGCAAACGATACCCTCAGTATAAAGTTCCAACTGAATTTGATGATTTCCCCAGCAAGGCAAAGTTGATAATCTCTTCTGGAAAGCTTATCAAAGAAGGTTTCAGTTTCAAGCATAGTATTGCTGAAACTTTTGACCAAACTGTGGAGTATTTGAAGACTCAGGGGATCAAGTGAATAAATATATAAATGGAGAGTGAAATATTGTGAACTCCCTAGTGTATCGTCACTTCATTAAATATCTCTCTATTCTAACTATCTATGAGATTGCCATTTCAGTaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Mtr.6064 translated coding region predicted by ESTScan from UniGene Mtr.6064

MASIKQIEIEKKKACVIGGTGFVASLLIKQLLEKGYAVNTTVRDLDSANKTSHLIALQSLGELNLFKAELTIEEDFDAPISGCELVFQLATPVNFASQDPENDMIKPAIKGVLNVLKACVRAKEVKRVILTSSAAAVTINELEGTGHVMDETNWSDVEFLNTAKPPTWGYPVSKVLAEKAAWKFAEENNIDLITVIPTLTIGPSLTQDIPSSVAMGMSLLTGNDFLINALKGMQFLSGSISITHVEDICRAHIFVAEKESTSGRYICCAHNTSVPELAKFLSKRYPQYKVPTEFDDFPSKAKLIISSGKLIKEGFSFKHSIAETFDQTVEYLKTQGIK

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-334 NAD(P)-bd

MASIKQIEIEKKKACVIGGTGFVASLLIKQLLEKGYAVNTTVRDLDSANKTSHLIALQSLGELNLFKAELTIEEDFDAPISGCELVFQLATPVNFASQDPENDMIKPAIKGVLNVLKACVRAKEVKRVILTSSAAAVTINELEGTGHVMDETNWSDVEFLNTAKPPTWGYPVSKVLAEKAAWKFAEENNIDLITVIPTLTIGPSLTQDIPSSVAMGMSLLTGNDFLINALKGMQFLSGSISITHVEDICRAHIFVAEKESTSGRYICCAHNTSVPELAKFLSKRYPQYKVPTEFDDFPSKAKLIISSGKLIKEGFSFKHSIAETFDQTVEYLKT

HMMPanther: PTHR10366:SF9
1-336 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

MASIKQIEIEKKKACVIGGTGFVASLLIKQLLEKGYAVNTTVRDLDSANKTSHLIALQSLGELNLFKAELTIEEDFDAPISGCELVFQLATPVNFASQDPENDMIKPAIKGVLNVLKACVRAKEVKRVILTSSAAAVTINELEGTGHVMDETNWSDVEFLNTAKPPTWGYPVSKVLAEKAAWKFAEENNIDLITVIPTLTIGPSLTQDIPSSVAMGMSLLTGNDFLINALKGMQFLSGSISITHVEDICRAHIFVAEKESTSGRYICCAHNTSVPELAKFLSKRYPQYKVPTEFDDFPSKAKLIISSGKLIKEGFSFKHSIAETFDQTVEYLKTQG

HMMPanther: PTHR10366
1-336 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MASIKQIEIEKKKACVIGGTGFVASLLIKQLLEKGYAVNTTVRDLDSANKTSHLIALQSLGELNLFKAELTIEEDFDAPISGCELVFQLATPVNFASQDPENDMIKPAIKGVLNVLKACVRAKEVKRVILTSSAAAVTINELEGTGHVMDETNWSDVEFLNTAKPPTWGYPVSKVLAEKAAWKFAEENNIDLITVIPTLTIGPSLTQDIPSSVAMGMSLLTGNDFLINALKGMQFLSGSISITHVEDICRAHIFVAEKESTSGRYICCAHNTSVPELAKFLSKRYPQYKVPTEFDDFPSKAKLIISSGKLIKEGFSFKHSIAETFDQTVEYLKTQG

Gene3D: G3DSA:3.40.50.720
IPR016040
12-208 NAD(P)-bd
NAD(P)-binding domain

KKACVIGGTGFVASLLIKQLLEKGYAVNTTVRDLDSANKTSHLIALQSLGELNLFKAELTIEEDFDAPISGCELVFQLATPVNFASQDPENDMIKPAIKGVLNVLKACVRAKEVKRVILTSSAAAVTINELEGTGHVMDETNWSDVEFLNTAKPPTWGYPVSKVLAEKAAWKFAEENNIDLITVIPTLTIGPSLTQD

HMMPfam: PF01370
IPR001509
15-265 Epimerase
NAD-dependent epimerase/dehydratase

CVIGGTGFVASLLIKQLLEKGYAVNTTVRDLDSANKTSHLIALQSLGELNLFKAELTIEEDFDAPISGCELVFQLATPVNFASQDPENDMIKPAIKGVLNVLKACVRAKEVKRVILTSSAAAVTINELEGTGHVMDETNWSDVEFLNTAKPPTWGYPVSKVLAEKAAWKFAEENNIDLITVIPTLTIGPSLTQDIPSSVAMGMSLLTGNDFLINALKGMQFLSGSISITHVEDICRAHIFVAEKESTSGRY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox