PRGDB00071229 (Mtr.7903)

From PRG Wiki
Jump to: navigation, search
Mtr.7903
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83667760 (DW018168)
Gene Class Unknown
Domain Type
Gene Species Medicago truncatula

Comment?

EST1227129 MTY Medicago truncatula cDNA clone MTYB314, mRNA sequence

DNA Sequence

CGGCCGGGAAGAGCATTTGGCAGTGGCAGTATAGCTCTTCCTTCTGCCATACTTCACCAAACTACCTGAGGTGGTTCTTTGGTGGGAAAAAAAGCAAAGAATTGCTTGAATTTAAAGAGGTTGAAATTTCAAGCAAGGGAAGATGGATTATGTTAATGGACCAGGAAGAAACCATCTCTTTGTTCCAGGGCCGGTTAACATACCAGACCAGGTCATTCGGGCTATGAGCCGAAACAACGAGGACTATCGTTCTCCTGCAATTCCAGCTCTGACAAAAACTCTACTTGAAGATGTCAAGAAGATTTTCAAGACTACTACTGGAACTCCATTTCTTATCCCTACTACTGGTACCGGTGCTTGGGAGAGTGCTCTGACAAACACATTGTCACCTGGAGATCGTATTGTATCTTTCGTGATTGGCCAATTCAGTTTGCTTTGGGTTGATCGGCAGCAACGCCTTAAATTTAATGTCGATGTTGTGGAAAGTGAATGGGGCCGTGGTGCTGATCTCGACATTCTAGAATCAAAACTTGCTTCTGATTCTGCACACACTATAAAGGCTATTTGCATTGTTCATAATGAGACTGCAACTGGGTGTCACCAATAACTTGGCCAAAGTTCGACAACTTTCTCGATGCATACCAACATCCAGCCCTCCTCCTTGTTGATGGAGTGTCATCCCATTTGTGCTCTCGATTTCCGTATGGACGAATGGGGAGTAGATGTGGCCATAACTGGTTCTCAGAAAGCCCTTTCCCTTCCTACTGGTATAGGATTTGTGGTTGCAAGCCCTAAGCCATCGAAGCTTCAAAATCTGCCAATCACTTCGAGTTTTCTTTGATTGGAGTGACTACCTGA


Protein sequences

Name Description Sequence
Mtr.7903 translated coding region predicted by ESTScan from UniGene Mtr.7903

MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDRQQRLKFNVDVVESEWGRGADLDILESKLASDSAHTIKAICIVHNETATGCHQXLGQSSTTFSMHTNIQPSSLLMECHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKPSKLQNLPITSSFL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-218 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDRQQRLKFNVDVVESEWGRGADLDILESKLASDSAHTIKAICIVHNETATGCHQXLGQSSTTFSMHTNIQPSSLLMECHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPK

HMMPanther: PTHR21152
1-218 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYVNGPGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDRQQRLKFNVDVVESEWGRGADLDILESKLASDSAHTIKAICIVHNETATGCHQXLGQSSTTFSMHTNIQPSSLLMECHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPK

superfamily: SSF53383
IPR015424
7-218 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDRQQRLKFNVDVVESEWGRGADLDILESKLASDSAHTIKAICIVHNETATGCHQXLGQSSTTFSMHTNIQPSSLLMECHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPK

HMMPfam: PF00266
IPR000192
12-218 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDRQQRLKFNVDVVESEWGRGADLDILESKLASDSAHTIKAICIVHNETATGCHQXLGQSSTTFSMHTNIQPSSLLMECHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPK

Gene3D: G3DSA:3.40.640.10
IPR015421
21-221 no description
Pyridoxal phosphate-dependent transferase, major r

PDQVIRAMSRNNEDYRSPAIPALTKTLLEDVKKIFKTTTGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDRQQRLKFNVDVVESEWGRGADLDILESKLASDSAHTIKAICIVHNETATGCHQXLGQSSTTFSMHTNIQPSSLLMECHPICALDFRMDEWGVDVAITGSQKALSLPTGIGFVVASPKPSK

Seg: seg
57-71 seg

TTTGTPFLIPTTGTG

PatternScan: PS00595
IPR020578
193-213 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVAITGSQKALSLPTGIGFV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox