PRGDB00071280 (Mtr.10182)

From PRG Wiki
Jump to: navigation, search
Mtr.10182
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 6605758 (AW257501)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

EST305638 KV2 Medicago truncatula cDNA clone KV2-10E7, mRNA sequence

DNA Sequence

GTCTTTAGAAATGAATTATATAACCTTGACATTTGGTATGAGTCATAGTCTCATACGGCCATACAAACAACTAGAAATTTAATTAAATATAATAAAGATGATCAAGGCCAACAAGATACCTACAAATATACTAAATTTTTTATCTTAGTTTCTCTCAAACATAAGAGATGTATTTTAAATTTCAACAAGCAGACACTAAAATATCATCTCATTTTGCGCCTATCATTGTCACTTAGTATTTTCAAATTGTTGGACTGCATTGTTACAAACTCTTCATAGTTTTCATCATTTTCTTCATCATGTCCCTTATTGTTACTCAAATTTGGAATCTCTTTTTTTCTCTTTGAAACACCATCCTTAAGCCATTCCACCACCTCTATCATGCTAGGCCTTTTATCAGGACTACTATCAGTGCACCTCACAGCTATCATAATCACAGATTTCAATTGCTCTAAATCAAAATTCCCTTTCAATTTTGGATCAGCAATATGTTTAAAAACACCCTTTTGTACATATGGTGTGACCCATTGAACAATGTCCCTTTTTATTCCACCAGGTAGTTTTTCAATTGGTTTCTTGGCACTTATAATCTCCAAAAGCAAAATTCCAAAGCTATAAACATCACAACTCTCAGAAACCTTACCCCACATAGCATATTCTGGTGCCAAATAACCAAGTGTGCCTTTAACCCTTGTTGTAAGATGGCTTACACCTGCTGGTATTAGCTTTTGCAAAACCAAAATCAG


Protein sequences

Name Description Sequence
Mtr.10182 translated coding region predicted by ESTScan from UniGene Mtr.10182

LILVLQKLIPAGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCTDSSPDKRPSMIEVVEWLKDGVSKRKKEIPNLSNNKGHDEENDENYEEFVTMQSNNLKILSDNDRRKMR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-129 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LILVLQKLIPAGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCTDSSPDKRPSMIEVVEWL

superfamily: SSF56112
IPR011009
5-175 Protein kinase-like (PK-like)
Protein kinase-like domain

LQKLIPAGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCTDSSPDKRPSMIEVVEWLKDGVSKRKKEIPNLSNNKGHDEENDENYEEFVTMQSNNLKILSDND

HMMPanther: PTHR24420
7-130 FAMILY NOT NAMED,FAMILY NOT NAMED

KLIPAGVSHLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCTDSSPDKRPSMIEVVEWLK

HMMPfam: PF00069
IPR017442
15-126 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

HLTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCTDSSPDKRPSMIEVV

Gene3D: G3DSA:1.10.510.10
16-156 no description

LTTRVKGTLGYLAPEYAMWGKVSESCDVYSFGILLLEIISAKKPIEKLPGGIKRDIVQWVTPYVQKGVFKHIADPKLKGNFDLEQLKSVIMIAVRCTDSSPDKRPSMIEVVEWLKDGVSKRKKEIPNLSNNKGHDEENDEN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox