PRGDB00071335 (Mtr.13101)

From PRG Wiki
Jump to: navigation, search
Mtr.13101
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14870494 (BI266409)
Gene Class Unknown
Domain Type LRR
Gene Species Medicago truncatula

Comment?

NF085A09IN1F1069 Insect herbivory Medicago truncatula cDNA clone NF085A09IN 5', mRNA sequence

DNA Sequence

CAACAATAAAGTGTGATCCCTCCTTCAACTCCCTCTCTCCTATCAGTGTTCATGTTTGCAAAACTAGGCTTGAGAAGGTGTGTATGTTCTTTGGAGATCAAAGGGGTTTTCCATGTTGCCCCCAAATTCTAGCAGGGCTCCTTTCAAAATATTGATGAGGTGGTTCATATTCCTTGTTGTCTTGAAACTCAGTTCTGCAATCAAAGATCCTGATATAGAAGGTGAAGCTCTGCTTGATCTTTTGAATTACCTCAATGATTCAAATAATCAAATACAAGATTGGGATAGTCATTTAGTGAGCCCATGTTTCAGCTGGTCACATGTCACTTGTAGAAATGGACATGTCATATCTCTGACCCTGGCTTCTATTGGATTTTCTGGAACACTTTCTCCCTCAATTACCAGATTGAAATATTTGGTTAACTTGGAATTGCAGAACAACAATCTTTCAGGCCCCATACCTGATTACATTTCCAACTTGACAGACCTACAATATCTGAATCTTGCTAACAATAATTTTAATGGCTCTATACCGGTTAGTTGGGGTCAACTATCCAGTCTCAAGAATGTGTAAGGATTCATTTTCAATTTCTTATATGCTTCTTCTATGGGTTTTTTTCCCATATGCTTCCTATTNTGATATTGAATGCNATA


Protein sequences

Name Description Sequence
Mtr.13101 translated coding region predicted by ESTScan from UniGene Mtr.13101

MRWFIFLVVLKLSSAIKDPDIEGEALLDLLNYLNDSNNQIQDWDSHLVSPCFSWSHVTCRNGHVISLTLASIGFSGTLSPSITRLKYLVNLELQNNNLSGPIPDYISNLTDLQYLNLANNNFNGSIPVSWGQLSSLKNV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF422
1-139 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MRWFIFLVVLKLSSAIKDPDIEGEALLDLLNYLNDSNNQIQDWDSHLVSPCFSWSHVTCRNGHVISLTLASIGFSGTLSPSITRLKYLVNLELQNNNLSGPIPDYISNLTDLQYLNLANNNFNGSIPVSWGQLSSLKNV

HMMPanther: PTHR24420
1-139 FAMILY NOT NAMED,FAMILY NOT NAMED

MRWFIFLVVLKLSSAIKDPDIEGEALLDLLNYLNDSNNQIQDWDSHLVSPCFSWSHVTCRNGHVISLTLASIGFSGTLSPSITRLKYLVNLELQNNNLSGPIPDYISNLTDLQYLNLANNNFNGSIPVSWGQLSSLKNV

superfamily: SSF52058
16-137 L domain-like,LRR

IKDPDIEGEALLDLLNYLNDSNNQIQDWDSHLVSPCFSWSHVTCRNGHVISLTLASIGFSGTLSPSITRLKYLVNLELQNNNLSGPIPDYISNLTDLQYLNLANNNFNGSIPVSWGQLSSLK

HMMPfam: PF08263
IPR013210
22-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EGEALLDLLNYLNDSNNQIQDWDSHLVSPCFSWSHVTC

Gene3D: G3DSA:3.80.10.10
22-138 no description

EGEALLDLLNYLNDSNNQIQDWDSHLVSPCFSWSHVTCRNGHVISLTLASIGFSGTLSPSITRLKYLVNLELQNNNLSGPIPDYISNLTDLQYLNLANNNFNGSIPVSWGQLSSLKN

Seg: seg
26-38 seg

LLDLLNYLNDSNN

HMMPfam: PF00560
IPR001611
88-109 LRR_1
Leucine-rich repeat

LVNLELQNNNLSGPIPDYISNL

HMMPfam: PF00560
IPR001611
112-132 LRR_1
Leucine-rich repeat

LQYLNLANNNFNGSIPVSWGQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox