PRGDB00071391 (Mtr.15923)

From PRG Wiki
Jump to: navigation, search
Mtr.15923
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83664885 (DW015293)
Gene Class Unknown
Domain Type
Gene Species Medicago truncatula

Comment?

EST1224254 MTY Medicago truncatula cDNA clone MTYA329, mRNA sequence

DNA Sequence

CGGCCGGGGGTGGAACTtagagagagaaagaaagagagCTTTTGAGATAGCTTGAATTGAGGGTTTTCACTTTGAGATAGAGAGATAGTGTTTGTGTGACACATATTTTTAACTATTCCAAAATTTACAAATAGTTTTATTATATTCAACAAGAAATGGCCATGACTCGTGAATCTTGGGCTTTTGTTTTCGGCATTATAGGCAACATCATTTCCTTTGCGGTGTTCCTCTCACCATTGCCAACTTTTTACGTAATCTTCAAGAAGAAATCTGCTGAAGGATTTCAGGCACTTCCTTATGTTGTGGCACTTTTCAGTGCAATGCTTTGGATCTACTATGCATTTGTCAAAAGAGAATCTGCTCTTCTTCTCATCACCATTAACACTTTTGGAATTGTTGTTGAATCAGCTTACATTATAATGTTCCTAATTTATGCCCCAAAGAAACAAAGGCTTTCAACCATAAAACTACTTCTCTTGCTGAATGTGTTTGGGTTTGGAGCCATGCTTCTATCAACTCTCTACCTTTCAAAGGGAGCAAAACGTCTTGCTATCATTGGATGGATTTGCCTTGTTTTCAACATAAGTGTATTTGCTACACCTCTCTTCGTCATTAGCAAAGTCATAAGGTCAAGGAGCGTTGAATACATGCCATTTTTCTTGTCCTTCTTTTTAACTATCAATGCTGTTATGTGGTTCTTCTATGGCCTTCTCCTCAGGGATTACTATGTTGCTCTACCAAACACACTTGGATTTGTGTTCGGTATAATTCAGATGGTGGTGTATTTGATATATAGAAATGCTACACCAGTGGTAGAGGCACCAATGAAGGGTCAAGAGTTGAGTGGTGGTCATATAATTGATGTTGTGAAGATTGGAACAGATCCCAATCGTGCAGTGAGTGCGGTAGCAAAGTCTGATTTTAACATGGGATCATGACGGGA


Protein sequences

Name Description Sequence
Mtr.15923 translated coding region predicted by ESTScan from UniGene Mtr.15923

MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYLSKGAKRLAIIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVVEAPMKGQELSGGHIIDVVKIGTDPNRAVSAVAKSDFNMGSXRX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
1-220 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

MAMTRESWAFVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKKQRLSTIKLLLLLNVFGFGAMLLSTLYLSKGAKRLAIIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNATPVV

HMMPfam: PF03083
IPR004316
10-97 MtN3_slv
RAG1-activating protein-1-related

FVFGIIGNIISFAVFLSPLPTFYVIFKKKSAEGFQALPYVVALFSAMLWIYYAFVKRESALLLITINTFGIVVESAYIIMFLIYAPKK

HMMPfam: PF03083
IPR004316
133-216 MtN3_slv
RAG1-activating protein-1-related

IIGWICLVFNISVFATPLFVISKVIRSRSVEYMPFFLSFFLTINAVMWFFYGLLLRDYYVALPNTLGFVFGIIQMVVYLIYRNA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox