PRGDB00071409 (Mtr.17787)

From PRG Wiki
Jump to: navigation, search
Mtr.17787
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14878414 (BI270634)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

NF010F09FL1F1079 Developing flower Medicago truncatula cDNA clone NF010F09FL 5', mRNA sequence

DNA Sequence

GAATCATTAAAAAATAACAAAGGCTTGTGTGGTAATCACACTGGTCTAATGCTTTGCCCAACTAGCCACAGTAAAAAGAGACACCGAGATCCTCCTTCTAGTATTGTTTGTCATCTTAGGTGCTCTAGTACTAGTATTTTCTGGGTTGGGAATTTCAATGTATATTATTTATCGGAGAGCAAGAAAGACAAAAAACAAGGATAAAGATTCTAATGAAGCACAAGCAGAAGAAGTCTTTTCCATATGGAGTCATGATGGAAAAATGATGTTTGAAAATATAATTGAAGCTACCAACAATTTTGATGATGAATACCTCATTGGAGTGGGAGGGGAAGGATCTGTTTACAAGGCTAAGTTGTCTGCAGATATGGTTGTTGCAGTGAAGAAACTTCATTCGAGAATAGATGGGGAAAGGTCCAATATCAAAGCCTTTGAAAATGAAATTCAAGCTTTGACAGAAATCAGGCATCGTAACATCATAAAGCTCTATGGATATTGCCGACATTCAAGATTCTCATTTTTGGTTTATAAGTTCTTGGAAGGTGGAACTTTGACTCAAATGTTAAACAATGACACACAAGCCATTGCATTTGATTGGGAAAAGAGGGTGAATATTGNTAGAGGTGTGGCTGA


Protein sequences

Name Description Sequence
Mtr.17787 translated coding region predicted by ESTScan from UniGene Mtr.17787

MMFENIIEATNNFDDEYLIGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYGYCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIXRGVAX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF472
1-123 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MMFENIIEATNNFDDEYLIGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYGYCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIXRGVA

HMMPanther: PTHR24420
1-123 FAMILY NOT NAMED,FAMILY NOT NAMED

MMFENIIEATNNFDDEYLIGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYGYCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIXRGVA

superfamily: SSF56112
IPR011009
2-123 Protein kinase-like (PK-like)
Protein kinase-like domain

MFENIIEATNNFDDEYLIGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYGYCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIXRGVA

Gene3D: G3DSA:3.30.200.20
3-77 no description

FENIIEATNNFDDEYLIGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYG

ProfileScan: PS50011
IPR000719
13-124 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDDEYLIGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYGYCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIXRGVAX

HMMPfam: PF07714
IPR001245
19-119 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

IGVGGEGSVYKAKLSADMVVAVKKLHSRIDGERSNIKAFENEIQALTEIRHRNIIKLYGYCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIX

Coil: coil
40-68 coiled-coil

VKKLHSRIDGERSNIKAFENEIQALTEIR

Gene3D: G3DSA:1.10.510.10
78-123 no description

YCRHSRFSFLVYKFLEGGTLTQMLNNDTQAIAFDWEKRVNIXRGVA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox