PRGDB00071496 (Mtr.23397)

From PRG Wiki
Jump to: navigation, search
Mtr.23397
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83664671 (DW015079)
Gene Class Unknown
Domain Type
Gene Species Medicago truncatula

Comment?

EST1224040 MTY Medicago truncatula cDNA clone MTYA064, mRNA sequence

DNA Sequence

AGCCAGCAGGTTCTTTAAGCAATTTTTGTTGGTGTTCCTTATCCAACAAATGGCAGCTGGGATGTTTAGGTTCATTGCTGGAACATGTAGGACAATGATTATTGCAAATACTGGTGGAGCACTCATGCTTCTTGTTGTTTTTCTACTTGGTGGTTTCATCCTTCCTAAACGTTCAATTCCTGACTGGTGGGTTTGGGCTAATTGGGTTTCACCATTGACCTATGCTTACCATGCCTTGGTTGTGAATGAAATGTATGCTCCAAGATGGATGCATCCAAATACTTCTGGAGATAAAACTACCACATTGGGTCTGGCTGTATTGAAGAACTTTGATGTTTATGCTAATGAAAATTGGTATTGGATTGGTGCTGGAGCTCTTGCTGTTTTAATTGTTTTTTACAATGTTCTCTTCACCCTTACACTTATGTACCTAAGTCCTTTTGGAAACAAACAAGCAATTATATCTGAGGAAGATGCAACTGAGTTGGAGGGTGAAGGAGATGTAAACGAACCAAGACTCGTGAGGCCGCCTTCCAACCGAGAATCAATGCTTCGATCACTATCCAAAGCTGATGGAAACAATTCAAGGGAAGTGGCAATGCAAAGAATGAGTAGCCAAAATCCAAACGGATTAAGAAATGCTGATGCAGACACTGGAAATGCACCAAGAAGAGGAATGATTCTACCTTTCCAACCACTTGCAATGTCCTTTGAGAGTGTTAATTACTTTGTGGACATGCCTGCAGAAATGAAAGAGCAGGAGTGACAGAAAGAT


Protein sequences

Name Description Sequence
Mtr.23397 translated coding region predicted by ESTScan from UniGene Mtr.23397

MAAGMFRFIAGTCRTMIIANTGGALMLLVVFLLGGFILPKRSIPDWWVWANWVSPLTYAYHALVVNEMYAPRWMHPNTSGDKTTTLGLAVLKNFDVYANENWYWIGAGALAVLIVFYNVLFTLTLMYLSPFGNKQAIISEEDATELEGEGDVNEPRLVRPPSNRESMLRSLSKADGNNSREVAMQRMSSQNPNGLRNADADTGNAPRRGMILPFQPLAMSFESVNYFVDMPAEMKEQEXQKD


Domains

Domain Start-End Description Sequence

HMMPfam: PF01061
IPR013525
1-67 ABC2_membrane
ABC-2 type transporter

MAAGMFRFIAGTCRTMIIANTGGALMLLVVFLLGGFILPKRSIPDWWVWANWVSPLTYAYHALVVNE

HMMPanther: PTHR19241
1-128 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

MAAGMFRFIAGTCRTMIIANTGGALMLLVVFLLGGFILPKRSIPDWWVWANWVSPLTYAYHALVVNEMYAPRWMHPNTSGDKTTTLGLAVLKNFDVYANENWYWIGAGALAVLIVFYNVLFTLTLMYL

Seg: seg
22-38 seg

GGALMLLVVFLLGGFIL

HMMPfam: PF08370
IPR013581
73-139 PDR_assoc
Plant PDR ABC transporter associated

WMHPNTSGDKTTTLGLAVLKNFDVYANENWYWIGAGALAVLIVFYNVLFTLTLMYLSPFGNKQAIIS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox