PRGDB00071514 (Nta.542)

From PRG Wiki
Jump to: navigation, search
Nta.542
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76871256 (DV162248)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KP1B.110I21F.050727T7 KP1B Nicotiana tabacum cDNA clone KP1B.110I21, mRNA sequence

DNA Sequence

GGAGCGGAAGCGAAGGAAGCTCCGGCTCCGCTGCCGGCGGCGGAGAAGCTGTCGCACCGGTAGCAGCGTCAACGGAGAAGAAGAAGGAGAAGTCAAGAGTAAGCAAAACATCGCAAATTCTATGGCACGCTCACCATAACGATGCAGCTGCCGTTCGGAAGCTTCTAGAAGAAGATCGGACGCTTGTTCAAGCTAGGGATTACGATAATCGTACTCCGCTTCATGTCGCGGCGTTACATGGCTGGATCGATGTTGCGAAGTGCTTGATCGATTATGGCGCCGACGTCAACGCTCAGGATCGTTGGAGAAATACGCCTCTAGCCGACGCAGAAGGAGCTAAGAAACATGGCATGATTGAATTGTTAAAGACATATGGTGGACTATCTTATGGGCAAAATGGAAGCCATTTTGAACCAAGGGCTGTTCCACCCCCTCTACCAAAGAAGTGTGACTGGGAGATTGATCCTGCTGAGCTGGACTTCTCAAATTCTGTAATCATTGGGAAGGGGTCTTTTGGTGAGATATTAAAAGCTTGCTGGCGTGGAACACCTGTAGCTGTTAAACGCATCCTCCCAAACCTTTCAGATGATCGATTGGTGATTCAGGATTTCAGGCATGAGGTAAATTTGTTGGTGAAGCTCCGTCATCCAAATATAGTGCAATTTCTTGGAGCTGTTACTGAGAAAAAACCCTTGATGTTAATAACTGAGTACTTAAGGGGGGGTGATCTGCATCAGCACCTCAAGGAAAGAGGTGCTCTTAGTCCATCGACAGCAATCAATTTTGCTATGGATATCGCAAGAGGCATGACTTATCTTCACAATGAGCCGAATGTTATAATCCACAGGGATCTAAAGCCCAGGAATGTTCTTCTAGTCAACTCCAATGCAGACCATTTGAAAGTTGGAGACTTTGGATTAAGCAAACTAATCAGGGTTCAGAACTCCCATGA


Protein sequences

Name Description Sequence
Nta.542 translated coding region predicted by ESTScan from UniGene Nta.542

XSGSEGSSGSAAGGGEAVAPVAASTEKKKEKSRVSKTSQILWHAHHNDAAAVRKLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYGGLSYGQNGSHFEPRAVPPPLPKKCDWEIDPAELDFSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRVQNSHX

Domains

Domain Start-End Description Sequence

Seg: seg
2-24 seg

SGSEGSSGSAAGGGEAVAPVAAS

superfamily: SSF48403
IPR020683
34-126 Ankyrin repeat
Ankyrin repeat-containing domain

VSKTSQILWHAHHNDAAAVRKLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYG

ProfileScan: PS50297
IPR020683
35-126 ANK_REP_REGION
Ankyrin repeat-containing domain

SKTSQILWHAHHNDAAAVRKLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYG

Gene3D: G3DSA:1.25.40.20
IPR020683
35-126 no description
Ankyrin repeat-containing domain

SKTSQILWHAHHNDAAAVRKLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYG

HMMPfam: PF12796
IPR020683
43-126 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

HAHHNDAAAVRKLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYG

HMMPanther: PTHR23257:SF89
54-312 ANKYRIN-KINASE,ANKYRIN-KINASE

KLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYGGLSYGQNGSHFEPRAVPPPLPKKCDWEIDPAELDFSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIR

HMMPanther: PTHR23257
54-312 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

KLLEEDRTLVQARDYDNRTPLHVAALHGWIDVAKCLIDYGADVNAQDRWRNTPLADAEGAKKHGMIELLKTYGGLSYGQNGSHFEPRAVPPPLPKKCDWEIDPAELDFSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIR

ProfileScan: PS50088
IPR002110
69-101 ANK_REPEAT
Ankyrin repeat

DNRTPLHVAALHGWIDVAKCLIDYGADVNAQDR

HMMSmart: SM00248
IPR002110
69-98 ankyrin repeats
Ankyrin repeat

DNRTPLHVAALHGWIDVAKCLIDYGADVNA

superfamily: SSF56112
IPR011009
131-317 Protein kinase-like (PK-like)
Protein kinase-like domain

GQNGSHFEPRAVPPPLPKKCDWEIDPAELDFSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRVQNSH

Gene3D: G3DSA:3.30.200.20
136-224 no description

HFEPRAVPPPLPKKCDWEIDPAELDFSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLG

ProfileScan: PS50011
IPR000719
161-318 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRVQNSHX

HMMSmart: SM00219
IPR020635
161-318 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRVQNSHX

HMMSmart: SM00220
IPR002290
161-318 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNSVIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRVQNSHX

HMMPfam: PF00069
IPR017442
165-315 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VIIGKGSFGEILKACWRGTPVAVKRILPNLSDDRLVIQDFRHEVNLLVKLRHPNIVQFLGAVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLIRVQN

PatternScan: PS00107
IPR017441
167-188 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGSFGEILKACWRGTPVAVK

Gene3D: G3DSA:1.10.510.10
225-311 no description

AVTEKKPLMLITEYLRGGDLHQHLKERGALSPSTAINFAMDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSNADHLKVGDFGLSKLI

PatternScan: PS00108
IPR008271
280-292 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPRNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox