PRGDB00071520 (Nta.1068)

From PRG Wiki
Jump to: navigation, search
Nta.1068
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76870433 (DV161425)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KP1B.108B02F.050726T7 KP1B Nicotiana tabacum cDNA clone KP1B.108B02, mRNA sequence

DNA Sequence

GGTCCTCTTCTATGGTTCAAGTATCTCTCATCTGTACTTGTCTCCCTTAATTCTCTGAAATTTATCAGACACACATATTTCTAAATTTTTCTATAACAGAGGAGATGAGATACGTTCGTACAAGTAGCCTTAAGAGGCTGTTTTCTTTCGGAAGACACAGTTTTGATGGAGATTTTCCAATAGCTTGTGAAGAAAATAATACTACAAGTACCGCTATTGTTGCTGATACTGCTTCCCCCACAACACAGCCAACTCATAGGCCCACATGGAAATGTTTCTCTTATCAAGAAATTTTTCGTGCCACCAACGGTTTCGACTCAGAAAATATGGTTGGGAAAGGAGGGTATGCAGAAGTGTACAAAGGAGTATTAGATGATGGACAGGCAATAGCTGTAAAAATGCTGACAAAAGCCACCGATGATAAGAGAAAAGAGAAGGAATTTTTGACAGAAATTGGGACACTTGGTCACGTTCGCCATCCCAATGTGACATCATTGTTAGGTTGTTGTATTGAGGATGGGCTTTATCTCATTTTTCAGTTCTCTTCTAAAGGCTCTGTTGCTTCAATTCTCCATGATGAGATATCACCCACTATGGACTGGGAAACAAGGAACAAAATTGCTCTTGGAACTGCAAAGGGTTTATATTACTTGCATAAATCTTGTCCTAGAAGAATAATTCACAGGGACATCAAGGCTTCAAACATTTTGTTGAGTGAGGAATATGAGCCACAGATATCAGATTTTGGGCTAGCAAAATGGCTTCCATCACAATGGACCCATCATTCCATTGTTCCAATTGAAGGGACTTTTGGGCACTTAGCACCAGAATATTTCATGCATGGAGTAGTTGATGAAAAGACAGATGTTTTTGCATTTGGTGTGTTCTGCTTGGAGCTCATTTCTGGGAAAAAACCAGTTGACAATTCCCATCAAAGCTTACACAGCTGGGCAAAACCTCTTTTGAGC


Protein sequences

Name Description Sequence
Nta.1068 translated coding region predicted by ESTScan from UniGene Nta.1068

MRYVRTSSLKRLFSFGRHSFDGDFPIACEENNTTSTAIVADTASPTTQPTHRPTWKCFSYQEIFRATNGFDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQSLHSWAKPLLS

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
42-276 Protein kinase-like (PK-like)
Protein kinase-like domain

TASPTTQPTHRPTWKCFSYQEIFRATNGFDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSH

Gene3D: G3DSA:3.30.200.20
50-133 no description

THRPTWKCFSYQEIFRATNGFDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLG

HMMPanther: PTHR24420:SF548
52-287 SUBFAMILY NOT NAMED

RPTWKCFSYQEIFRATNGFDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQSLHSWAKPLL

HMMPanther: PTHR24420
52-287 FAMILY NOT NAMED,FAMILY NOT NAMED

RPTWKCFSYQEIFRATNGFDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQSLHSWAKPLL

ProfileScan: PS50011
IPR000719
70-288 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQSLHSWAKPLLS

HMMSmart: SM00220
IPR002290
70-283 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQSLHSWA

HMMSmart: SM00219
IPR020635
70-287 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDSENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQSLHSWAKPLL

HMMPfam: PF00069
IPR017442
73-277 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ENMVGKGGYAEVYKGVLDDGQAIAVKMLTKATDDKRKEKEFLTEIGTLGHVRHPNVTSLLGCCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSHQ

PatternScan: PS00107
IPR017441
76-98 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGGYAEVYKGVLDDGQAIAVK

Gene3D: G3DSA:1.10.510.10
134-276 no description

CCIEDGLYLIFQFSSKGSVASILHDEISPTMDWETRNKIALGTAKGLYYLHKSCPRRIIHRDIKASNILLSEEYEPQISDFGLAKWLPSQWTHHSIVPIEGTFGHLAPEYFMHGVVDEKTDVFAFGVFCLELISGKKPVDNSH

PatternScan: PS00108
IPR008271
191-203 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox