PRGDB00071521 (Nta.1116)

From PRG Wiki
Jump to: navigation, search
Nta.1116
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 92010897 (EB424657)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

KF8C.101C11F.051214T7 KF8 Nicotiana tabacum cDNA clone KF8C.101C11, mRNA sequence

DNA Sequence

AAGCAAAAAAATTGTTTCTTTTAGCCAACCTGTTTGTTTTGGCGCTATTTATACATATATCTCTATTACCGCTTTTCCCCATAAACCACCATTCTACAGCACCGTTTTCCTTCTCAACATAATCTTTTGCTTCACAATATCCTCTTCATTTTTCCTTTCCTTTCTAAGCTCTTTCCAACTTTCTTaaaaaaaactaaaaaCCTCTGCCATGGCAATCATCAAAATTCTCCACACTTTATTTGGGATTTTTGGCAATGTTACTGGTTTGTTTCTCTTTTTGGCCCCCATGATTACATTTAAGAGGGTCATTATGAATAAATCAACAGAACAATTTTCAGGCATACCATATGTAATGACTCTGCTCAACTGCTTACTCTCTACTTGGTATGGTCTGCCATTTGTGTCACCAAACAACATACTGGTATCAATAATCAATGGCACAGGTGCAGGACTTGAGGCATTCTATGTGTTGACATTCCTCACATTTGCACCCAAAAGGGAGAAGGCAAAAATCTCTGGAATTCTATTTGTAGTCCTTTCCATATTCTCAACTGTGGCATTGGTCTCCATGTTAGCCCTCCATGGCAATAAAAGGAAGATCTTTTGTGGCTTTGCTGCTGCAATTTTCTCTATCATTATGTATGGTTCTCCTTTGTCAATTATGAGGCTAGTGATTAAGACTAAAAGCGTGGAGTACATGCCATTCTTCTTGTCCTTGTTTGTCTTTCTCTGTGGTACCTCATGGTTCGTCTATGGATTGCTTGGGAAGGACCCTTTCATTGCTGTACCAAACGGGGTCGGAGGTTTGCTAGGAACAACACAACTGATATTGTACGCAATCTACAGAGACAACAAAGGGAAAGGGAAAGGCAAGAAAGGCGAGG


Protein sequences

Name Description Sequence
Nta.1116 translated coding region predicted by ESTScan from UniGene Nta.1116

MTLLNCLLSTWYGLPFVSPNNILVSIINGTGAGLEAFYVLTFLTFAPKREKAKISGILFVVLSIFSTVALVSMLALHGNKRKIFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGLLGKDPFIAVPNGVGGLLGTTQLILYAIYRDNKGKGKGKKGEX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
1-165 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

MTLLNCLLSTWYGLPFVSPNNILVSIINGTGAGLEAFYVLTFLTFAPKREKAKISGILFVVLSIFSTVALVSMLALHGNKRKIFCGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGLLGKDPFIAVPNGVGGLLGTTQLILYAIYR

HMMPfam: PF03083
IPR004316
85-168 MtN3_slv
RAG1-activating protein-1-related

CGFAAAIFSIIMYGSPLSIMRLVIKTKSVEYMPFFLSLFVFLCGTSWFVYGLLGKDPFIAVPNGVGGLLGTTQLILYAIYRDNK

Seg: seg
168-176 seg

KGKGKGKKG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox