PRGDB00071528 (Nta.1620)

From PRG Wiki
Jump to: navigation, search
Nta.1620
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 92012780 (EB426242)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KF8C.105J07F.051215T7 KF8 Nicotiana tabacum cDNA clone KF8C.105J07, mRNA sequence

DNA Sequence

CATTACGGCCGGGGATTATTCACAAGGtatatatatgtatacacagaatatatatacataGAGAAGTAGAAGAAGAGGGAGAAATGGGTTGGTTTCCATGTTCTGGATCATCGAAGCAGACCTCAAAGAAGAGGAAAAAGAAGAAAGACTCGACCAATTCGGTCCAACTTGGTTCTGAAAAGTTGAAGGCAAAGAATCTGTTAGGCTCAAAGGACGATGTTAAGGATGGAGAGTCTAGTCAAATTGCAGCCAAGACTTTCACATTTCGTGAATTAGCAGCTGCAGCAAGAAACTTTCGAGGTGATTGTCTTCTTGGAGAGGGAGGTTTTGGAAGAGTATACAAAGGGCGGCTCGATTCCAATCAGATTGTTGCCATCAAGCAACTCGATCGTAATGGATTGCAAGGGAACAGGGAATTTCTTGTTGAAGTGCTAATGCTAAGTTTGTTACACCATCCTAACCTGGTAAATTTAATTGGCTATTGTGCTGACGGAGATCAGAGACTTCTGGTTTACGAATATATGCCACTAGGATCATTGGATGACCATCTTCATGATCTTACGCCCGCTAAGAAAGTGCTCGATTGGAACACGAGAATGAAAATTGCAGCTGGAGCAGCAAAGGGCTTGGAATGTTTACATGACAAGCTTTGGGGTTGTCCTCTTGGAGATCATAACTGGCAGGAAAGCAATTGAAAATTCAAAAACTGGAGGAGAGCACAATCTGGTTGCATGGGCAAGACCCTTGTTCAAAGAGCGGAGGAAATTCTCACAGATGGCTGATCCTGTACTTCAAGGCCAATATCCCGTTAGAGGTTTGTATCAAGCTCTAGCAGTTGCAGCAATGTGTGTTCACGAGCAACCTAACATGCGTCCAGTCATAGCAGATGTTGTCACAGCCTTGTCTTACCTTGCTGCACAAAGATTTGACAGTGATAGTAC


Protein sequences

Name Description Sequence
Nta.1620 translated coding region predicted by ESTScan from UniGene Nta.1620

MGWFPCSGSSKQTSKKRKKKKDSTNSVQLGSEKLKAKNLLGSKDDVKDGESSQIAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAWNVYMTSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYLAAQRFDSDST

Domains

Domain Start-End Description Sequence

Seg: seg
7-26 seg

SGSSKQTSKKRKKKKDSTNS

superfamily: SSF56112
IPR011009
43-181 Protein kinase-like (PK-like)
Protein kinase-like domain

KDDVKDGESSQIAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKA

HMMPanther: PTHR24420:SF799
54-286 SUBFAMILY NOT NAMED

IAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAWNVYMTSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYLAAQRFDSDST

HMMPanther: PTHR24420
54-286 FAMILY NOT NAMED,FAMILY NOT NAMED

IAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAWNVYMTSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYLAAQRFDSDST

Gene3D: G3DSA:3.30.200.20
55-132 no description

AAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIG

ProfileScan: PS50011
IPR000719
71-286 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAWNVYMTSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYLAAQRFDSDST

HMMSmart: SM00220
IPR002290
71-276 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAWNVYMTSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTALSYL

HMMSmart: SM00219
IPR020635
71-273 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAWNVYMTSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTAL

HMMPfam: PF07714
IPR001245
76-182 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

LLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKAW

PatternScan: PS00107
IPR017441
77-99 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVYKGRLDSNQIVAIK

Gene3D: G3DSA:1.10.510.10
133-181 no description

YCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKA

superfamily: SSF56112
IPR011009
188-273 Protein kinase-like (PK-like)
Protein kinase-like domain

SFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKERRKFSQMADPVLQGQYPVRGLYQALAVAAMCVHEQPNMRPVIADVVTAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox