PRGDB00071532 (Nta.1935)

From PRG Wiki
Jump to: navigation, search
Nta.1935
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 92012094 (EB425603)
Gene Class Unknown
Domain Type LRR
Gene Species Nicotiana tabacum

Comment?

KF8C.103M14F.051214T7 KF8 Nicotiana tabacum cDNA clone KF8C.103M14, mRNA sequence

DNA Sequence

CCGGGATGCAATAACAGAAGAAAATGAACTCCtcttttcttcccattctttacctttctctcttccttttcctttcttttccctccccttctcACTCATTGAAATGCAATCCAAACGATAAAAAAGTCCTTCTAAAAATCAAGAATGACTTAGGTAATCCCTACCATTTAGCCTCATGGGATCCCAACACAGATTGCTGTGATTGGTACGTCGTAGAATGTGACCGGAAAACAAACCGGATTAATGCTCTCACCGTCTTCCAAGCCAACATCTCCGGTCAAATTCCGGCCGCCGTCGGCGACCTCCCTTTTCTCGAAACCTTACAATTCCATCATATCACCAATCTTACAGGAACCATTCCCCACACTATTACAAAGCTCATAAATCTGAAAGAGTTAAGACTCAGTTTCACTAATCTCAGTGGCCCTATTCCTGAATTTCTTAGCCAACTCAAGAATTTAACTTTGCTTGAATTAAACTACAACCAATTCACTGGAACAATCCCACCATCACTTTCTGAACTTCCTAATTTATCAGAAATCTACTTAGACCGCAATAAACTCACTGGACAAATTCCAGAATCATTCGGAAAATTCAGACAAATCCAAAATCTTTACCTTTCACATAACAGCCTCACTGGCCCAGTACCAAAATCTTTAGGCAATTTGAAATTTACAACACTTGATTTTTTAAGGAACAAGTTAGAAGGTGATGTTTCTTTCTTATTTGGAAAGAACAAGAAAATTCGACTAATTGATTTTTCAAGGAATACGTTTGAGTTTGATATTTCGAAAGTGGAATTCCCGGAGAGTTTAACGTGGTTGGATTTGAACCATAATCGGATTTTTGGTAGCTTACCAGAAGGATTGAAAGATTTACAGTTACAGAATT


Protein sequences

Name Description Sequence
Nta.1935 translated coding region predicted by ESTScan from UniGene Nta.1935

IKNDLGNPYHLASWDPNTDCCDWYVVECDRKTNRINALTVFQANISGQIPAAVGDLPFLETLQFHHITNLTGTIPHTITKLINLKELRLSFTNLSGPIPEFLSQLKNLTLLELNYNQFTGTIPPSLSELPNLSEIYLDRNKLTGQIPESFGKFRQIQNLYLSHNSLTGPVPKSLGNLKFTTLDFLRNKLEGDVSFLFGKNKKIRLIDFSRNTFEFDISKVEFPESLTWLDLNHNRIFGSLPEGLKDLQLQNX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF918
1-241 PGIP1 (POLYGALACTURONASE INHIBITING PROTEIN 1); PROTEIN BINDING

IKNDLGNPYHLASWDPNTDCCDWYVVECDRKTNRINALTVFQANISGQIPAAVGDLPFLETLQFHHITNLTGTIPHTITKLINLKELRLSFTNLSGPIPEFLSQLKNLTLLELNYNQFTGTIPPSLSELPNLSEIYLDRNKLTGQIPESFGKFRQIQNLYLSHNSLTGPVPKSLGNLKFTTLDFLRNKLEGDVSFLFGKNKKIRLIDFSRNTFEFDISKVEFPESLTWLDLNHNRIFGSLP

HMMPanther: PTHR24420
1-241 FAMILY NOT NAMED,FAMILY NOT NAMED

IKNDLGNPYHLASWDPNTDCCDWYVVECDRKTNRINALTVFQANISGQIPAAVGDLPFLETLQFHHITNLTGTIPHTITKLINLKELRLSFTNLSGPIPEFLSQLKNLTLLELNYNQFTGTIPPSLSELPNLSEIYLDRNKLTGQIPESFGKFRQIQNLYLSHNSLTGPVPKSLGNLKFTTLDFLRNKLEGDVSFLFGKNKKIRLIDFSRNTFEFDISKVEFPESLTWLDLNHNRIFGSLP

HMMPfam: PF08263
IPR013210
1-29 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

IKNDLGNPYHLASWDPNTDCCDWYVVECD

Gene3D: G3DSA:3.80.10.10
14-248 no description

WDPNTDCCDWYVVECDRKTNRINALTVFQANISGQIPAAVGDLPFLETLQFHHITNLTGTIPHTITKLINLKELRLSFTNLSGPIPEFLSQLKNLTLLELNYNQFTGTIPPSLSELPNLSEIYLDRNKLTGQIPESFGKFRQIQNLYLSHNSLTGPVPKSLGNLKFTTLDFLRNKLEGDVSFLFGKNKKIRLIDFSRNTFEFDISKVEFPESLTWLDLNHNRIFGSLPEGLKDLQ

superfamily: SSF52058
19-247 L domain-like,LRR

DCCDWYVVECDRKTNRINALTVFQANISGQIPAAVGDLPFLETLQFHHITNLTGTIPHTITKLINLKELRLSFTNLSGPIPEFLSQLKNLTLLELNYNQFTGTIPPSLSELPNLSEIYLDRNKLTGQIPESFGKFRQIQNLYLSHNSLTGPVPKSLGNLKFTTLDFLRNKLEGDVSFLFGKNKKIRLIDFSRNTFEFDISKVEFPESLTWLDLNHNRIFGSLPEGLKDL

HMMPfam: PF13516
83-104 LRR_6,Leucine Rich repeat

NLKELRLSFTNLSGPIPEFLSQ

HMMPfam: PF13855
107-166 LRR_8,Leucine rich repeat

NLTLLELNYNQFTGTIPPSLSELPNLSEIYLDRNKLTGQIPESFGKFRQIQNLYLSHNSL

HMMPfam: PF00560
IPR001611
225-247 LRR_1
Leucine-rich repeat

SLTWLDLNHNRIFGSLPEGLKDL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox