PRGDB00071540 (Nta.3327)

From PRG Wiki
Jump to: navigation, search
Nta.3327
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83422085 (DW004079)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KR3B.107L08F.051110T7 KR3B Nicotiana tabacum cDNA clone KR3B.107L08, mRNA sequence

DNA Sequence

GGCCATTACGGCCGGGGGGAAAATCAGGCACAGAAATATAGTAAAGTTGTATGCCAGTCTAATGAAAGAAGGTTCAAATTTCTTGGTTTTCGAGTACATGCCAAATGGTAATCTTTTCGAGGCACTACATCGAGAGATCAAGGCTGGCAAGCCAGAATTAGATTGGTACCAGAGATATAAAATAGCACTCGGAGCTGCAAAGGGAATTGCTTATCTGCACCATGATTGTTGCCCTCCTATTATTCATAGAGATATTAAATCAACGAACATTCTACTTGATGAGGATTATGAAGCAAAAGTTTCAGATTTTGGGGTTGCAAAAGTCTCAGAAATTTCTTCTAGGGGATCCGAGCTCAGTTGTTTTGCAGGCACTCATGGTTACATGGCTCCTGAAATGGCATATACTCTGAGAGTAACAGAAAAGAGTGACATTTACAGCTTTGGCGTCGTGCTATTGGAACTAGTAACGGGAAGAAAACCAATAGAAGATGCATTTGGAGAAGGCAAAGACTTGGTCTACTGGACGTCAACTCATTTAAATGACAAGGAAAGCATTGTCAAAGTTCTCGATCAGAAGGTGGTTTCTGAACTTGTTCAGGAAGACATGATCAAAGTGCTGAGAATCGCCACACTTTGTACAACCAAGCTTCCTAATTTGCGCCCCAACATGAAAGAAGTTGTCAAGTTGCTTGTTGATGCTGAACCTTGGACATTTAGATCTTCAAGCAAATCTGAGAAAAAGGGGCACAATTTTTCTGAGGTCTAGTTTCCCTATGTGGTTTCTTTTCCCTGTTGATAGTTGCTATGTAGTATAATTCTCAAGTTAGTTTAGGTATCTGATCTGAAATGATATTCCACTTTCTTTGTGTAAAAGTTGAATTCTGTAAAATGAAATGTATCTTTTCTGTTGTGGCTGGAAAGTTGAGAGGTTCTATTGATCTGTAC


Protein sequences

Name Description Sequence
Nta.3327 translated coding region predicted by ESTScan from UniGene Nta.3327

XAITAGGKIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEPW

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-237 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XAITAGGKIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEPW

HMMSmart: SM00220
IPR002290
3-237 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

ITAGGKIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEPW

HMMSmart: SM00219
IPR020635
3-231 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ITAGGKIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLL

HMMPanther: PTHR24420:SF112
7-236 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GKIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEP

HMMPanther: PTHR24420
7-236 FAMILY NOT NAMED,FAMILY NOT NAMED

GKIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLLVDAEP

superfamily: SSF56112
IPR011009
8-231 Protein kinase-like (PK-like)
Protein kinase-like domain

KIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKLL

Gene3D: G3DSA:3.30.200.20
8-38 no description

KIRHRNIVKLYASLMKEGSNFLVFEYMPNGN

HMMPfam: PF00069
IPR017442
8-229 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KIRHRNIVKLYASLMKEGSNFLVFEYMPNGNLFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVK

Gene3D: G3DSA:1.10.510.10
39-230 no description

LFEALHREIKAGKPELDWYQRYKIALGAAKGIAYLHHDCCPPIIHRDIKSTNILLDEDYEAKVSDFGVAKVSEISSRGSELSCFAGTHGYMAPEMAYTLRVTEKSDIYSFGVVLLELVTGRKPIEDAFGEGKDLVYWTSTHLNDKESIVKVLDQKVVSELVQEDMIKVLRIATLCTTKLPNLRPNMKEVVKL

PatternScan: PS00108
IPR008271
81-93 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox