PRGDB00071554 (Nta.3876)

From PRG Wiki
Jump to: navigation, search
Nta.3876
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 13924727 (AF252414)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum receptor-like protein kinase (PRK4) mRNA, partial cds

DNA Sequence

TTTTCCGGAGATATTCCTAAAGATTTCTTCTCTAAAATGGGATCTCTTaaaaaaatttggttttcaaaaaacaaattttCAGGACCAATTCCTGAATCTTTGGCCAACTTGAAATACTTATTGGAACTTCATCTTGAAAGTAATGAATTTTCAGGTCCTATTCCATCATTTTCACAGGCAAGTTTAACATCTATTGATCTGTCAAACAATAAATTGCAAGGTGAAATTCCTCAAAGCATGTCAAGATTTGGTGCAGACCCTTTTAAAGGGAATAATGAATTATGTGGGAAACAATTAGGGAAAGAATGCAACAAGGGAAAAGAGAATAATACTTTTCAAAGAGCACCAATGTCCAAGCTGAAATGGATAATTCTTGGTTTAGTTGTTAGTCTTCTGTTGATAACGATTCTTTTTAAGGCCAAGCGCAAGGAAGATCATTTCGACAAGCTTGGAAAAGAGAATCTTGACGAGGGGTTGCACGTTTCAAGCTCGAATAGGAAGAACACGAGCATTCATAGTAAGGGAGGTGATTCGGTGCATGGATCATCGCGAAGGGGAGCTGGATCGCAAAGGGGTAAGGCCATGGGCGATCTCGTGTTGGTAAACGAGGAAAAGGGTACGTTCGGATTGCCTGATTTGATGAAGGCAGCTGCTGAAGTCCTTGGGAACGGCGTATTAGGATCAGCTTATAAGGCAAAAATGGTTTATGGACTGTCTGTTGTGGTGAAAAGGTTGAGAGAGATGAATAAAATGAATAGGGATGTCTTTGATACAGAGATCAGGAAAATTAGCAAGTTAAGGCACAAGAATATATTGCAGTTATTGGCATACCATTAC


Protein sequences

Name Description Sequence
Nta.3876 translated coding region predicted by ESTScan from UniGene Nta.3876

FSGDIPKDFFSKMGSLKKIWFSKNKFSGPIPESLANLKYLLELHLESNEFSGPIPSFSQASLTSIDLSNNKLQGEIPQSMSRFGADPFKGNNELCGKQLGKECNKGKENNTFQRAPMSKLKWIILGLVVSLLLITILFKAKRKEDHFDKLGKENLDEGLHVSSSNRKNTSIHSKGGDSVHGSSRRGAGSQRGKAMGDLVLVNEEKGTFGLPDLMKAAAEVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAYHY

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-82 SSF52058,LRR

FSGDIPKDFFSKMGSLKKIWFSKNKFSGPIPESLANLKYLLELHLESNEFSGPIPSFSQASLTSIDLSNNKLQGEIPQSMSR

HMMPanther: PTHR24420:SF823
1-279 PTHR24420:SF823

FSGDIPKDFFSKMGSLKKIWFSKNKFSGPIPESLANLKYLLELHLESNEFSGPIPSFSQASLTSIDLSNNKLQGEIPQSMSRFGADPFKGNNELCGKQLGKECNKGKENNTFQRAPMSKLKWIILGLVVSLLLITILFKAKRKEDHFDKLGKENLDEGLHVSSSNRKNTSIHSKGGDSVHGSSRRGAGSQRGKAMGDLVLVNEEKGTFGLPDLMKAAAEVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAYHY

HMMPanther: PTHR24420
1-279 PTHR24420,FAMILY NOT NAMED

FSGDIPKDFFSKMGSLKKIWFSKNKFSGPIPESLANLKYLLELHLESNEFSGPIPSFSQASLTSIDLSNNKLQGEIPQSMSRFGADPFKGNNELCGKQLGKECNKGKENNTFQRAPMSKLKWIILGLVVSLLLITILFKAKRKEDHFDKLGKENLDEGLHVSSSNRKNTSIHSKGGDSVHGSSRRGAGSQRGKAMGDLVLVNEEKGTFGLPDLMKAAAEVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAYHY

Gene3D: G3DSA:3.80.10.10
2-82 G3DSA:3.80.10.10

SGDIPKDFFSKMGSLKKIWFSKNKFSGPIPESLANLKYLLELHLESNEFSGPIPSFSQASLTSIDLSNNKLQGEIPQSMSR

HMMPfam: PF00560
IPR001611
61-79 LRR_1
Leucine-rich repeat

SLTSIDLSNNKLQGEIPQS

ProfileScan: PS50011
IPR000719
215-279 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KAAAEVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAYHY

superfamily: SSF56112
IPR011009
216-279 Kinase_like
Protein kinase-like domain

AAAEVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAYHY

Gene3D: G3DSA:3.30.200.20
219-277 G3DSA:3.30.200.20

EVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAY

HMMPfam: PF07714
IPR001245
219-277 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EVLGNGVLGSAYKAKMVYGLSVVVKRLREMNKMNRDVFDTEIRKISKLRHKNILQLLAY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox