PRGDB00071571 (Nta.4358)

From PRG Wiki
Jump to: navigation, search
Nta.4358
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78216270 (DQ202472)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum CMV 1a interacting protein 2 (coi2) mRNA, complete cds

DNA Sequence

TAAGATACCACAGCTATGCTGACTTATGAAAGATTTTGGAAAAAGAAGGTGCCTCTCAATAGAACGATGTTTGGGGATTATGAAGTGATGCACATTATCTATCCAGGGCTGCCTTCTTCTCCTCCATCTGGCATTGATTCTGGTAATGGTCCAACTGGAAGTGCTGTCAATCAACAATTCCCTATTACTGCTGATTTTGTAAACAAGAGTCAGAGAATGAGTCCCCGAGTCATTTTTCTCATTGCTTCATCAGCATTAGTACTGTTGGTGGTATGCTGTGGTGCACTAGTTGTCCTCTTAAAATGCAGGAGGACTGGCCGACCGTCAAATGCTGTTGGTCCAGTGTTTACACCATCTATGCACAAGAGATCTGGTAAGGGAATTGGGTCGACAATATCAAGTAGCCCGACTAGTTCAACATCGATTTCCCTCATTTCTGCTATGCCTGCTTCTATCCTTTCTGTCAAAACATTTACGCTTGCGGAGCTTGAGAGGGCAACTGACAAGTTTAGTTTAAAAAGGGTTTTAGGTGAAGGAGGATTTGGACGTGTTTATCATGGTATCTTAGAAGACAGAACAGAAGTTGCCGTGAAAGTACTGACTAGGGATAACCAAAATGGAGATCGTGAATTCATTGCTGAAGTTGAGATGCTAAGCCGATTGCATCACCGTAACCTGGTGAAATTAATTGGTATATGCAGTGAAGAGCGGACTCGCAGCTTGGTATATGAACTTGTTCGGAACGGTAGTGTGGAGTCTCATTTGCATGGAAGAGACGGGAGAAAAGAGCCACTTGATTGGGATGTGAGGTTGAAAATTGCTCTTGGTGCTGCGAGAGGACTAGCTTACCTTCATGAAGATTCTAATCCTCGTGTAATTCATCGTGATTTTAAAGCCAGCAATGTTTTGTTAGAAGATGACTTCACGCCCAAGGTTGCAGATTTTGGGTTAGCAAGGGAAGCAACCGAAGGAAGTCACCACATATCTACAAGAGTCATGGGAACTTTTGGGTATGTTGCTCCTGAATATGCAATGACGGGACACCTACTTGTTAAAAGTGATGTGTATAGTTATGGAGTTGTATTATTGGAGCTTCTCTCCGGAAGAAAACCTGTGGACATGTCTCAACCTCCTGGAGAAGAAAACCTGGTAACTTGGGCGCGACCTCTTCTGACCACTAGAGAAGGTTTGGAGCAACTTGTGGATCCTTCTTTGGCTGGAAGCTATGACTTTGATGATATGGCAAAGGTGGCTGCCATTGCTTCAATGTGCGTTCACCCGGAGGTGACTCAAAGGCCATTTATGGGAGAAGTGGTGCAAGCTCTCAAACTAATTTATAATGACAATGATGAAACTTGTGCTGATGGATGTAGCCAGAAGGAGTCTTCTCTGCCAGATTCAGATTTCAAAGGTGTCCCTTCCGATAGCAGTTGGTGGAATGCTGGTGGGGTTACACCAAGATTAACATATGGACAAGCCTCCACTTTCATGACCATGGATTACAGTTCTGGTCCGCTTGAAGAGTTCGAAAACAGACCGTTTTCAGCTTCAAGTTTTAATCTTGGTGGAGGGGCGGGTTTAACAATAAGCCACGGTAACAGATCAGGTCCTTTGAGGACTGTAAGGAGTAAACCTGCTCTCTATAGGTTAAGGGGCAGTATGAGTGAACACGGTGCACTTCTTCCAAGACATGATTGGAGGGATGGCACCAATTATGATGCTTCTTTTTAGAGTGATTTGTCAAATGTACAGTGCCGAAGGCCGTTTCTATTTGGGAAAAAAGATGGTTCTCCGGTGTAGATTAGGAGTTTGAAATTGCCGCTGTATCCCTGAGAGAGTGGACTAAGCCTTCTAATTTTGGTAATCTTACATTCATTTTAATAGACAGGAAAGATAAACAGGACACTCCTTGTTGTATATGTTGTCAAATTAACTTTTTCTTTAGTCCAATATTGGATTGGACTACTAGTCTTTCTaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Nta.4358 translated coding region predicted by ESTScan from UniGene Nta.4358

MFGDYEVMHIIYPGLPSSPPSGIDSGNGPTGSAVNQQFPITADFVNKSQRMSPRVIFLIASSALVLLVVCCGALVVLLKCRRTGRPSNAVGPVFTPSMHKRSGKGIGSTISSSPTSSTSISLISAMPASILSVKTFTLAELERATDKFSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLIYNDNDETCADGCSQKESSLPDSDFKGVPSDSSWWNAGGVTPRLTYGQASTFMTMDYSSGPLEEFENRPFSASSFNLGGGAGLTISHGNRSGPLRTVRSKPALYRLRGSMSEHGALLPRHDWRDGTNYDASF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF804
54-497 ALE2 (ABNORMAL LEAF SHAPE 2); KINASE

RVIFLIASSALVLLVVCCGALVVLLKCRRTGRPSNAVGPVFTPSMHKRSGKGIGSTISSSPTSSTSISLISAMPASILSVKTFTLAELERATDKFSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLIYNDNDETCADGCSQKESSLPDSDFKGVPSDSSWWNAGGVTPRLTYGQASTFMTMDYSSGPLEEFENRPFSASSF

HMMPanther: PTHR24420
54-497 FAMILY NOT NAMED,FAMILY NOT NAMED

RVIFLIASSALVLLVVCCGALVVLLKCRRTGRPSNAVGPVFTPSMHKRSGKGIGSTISSSPTSSTSISLISAMPASILSVKTFTLAELERATDKFSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLIYNDNDETCADGCSQKESSLPDSDFKGVPSDSSWWNAGGVTPRLTYGQASTFMTMDYSSGPLEEFENRPFSASSF

Seg: seg
63-78 seg

ALVLLVVCCGALVVLL

Seg: seg
102-124 seg

SGKGIGSTISSSPTSSTSISLIS

superfamily: SSF56112
IPR011009
118-428 Protein kinase-like (PK-like)
Protein kinase-like domain

TSISLISAMPASILSVKTFTLAELERATDKFSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLIYNDND

Gene3D: G3DSA:3.30.200.20
133-209 no description

VKTFTLAELERATDKFSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIG

ProfileScan: PS50011
IPR000719
148-423 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLI

HMMSmart: SM00219
IPR020635
148-420 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQAL

HMMSmart: SM00220
IPR002290
148-423 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLI

HMMPfam: PF07714
IPR001245
149-420 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLKRVLGEGGFGRVYHGILEDRTEVAVKVLTRDNQNGDREFIAEVEMLSRLHHRNLVKLIGICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQAL

PatternScan: PS00107
IPR017441
154-176 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVYHGILEDRTEVAVK

Gene3D: G3DSA:1.10.510.10
210-423 no description

ICSEERTRSLVYELVRNGSVESHLHGRDGRKEPLDWDVRLKIALGAARGLAYLHEDSNPRVIHRDFKASNVLLEDDFTPKVADFGLAREATEGSHHISTRVMGTFGYVAPEYAMTGHLLVKSDVYSYGVVLLELLSGRKPVDMSQPPGEENLVTWARPLLTTREGLEQLVDPSLAGSYDFDDMAKVAAIASMCVHPEVTQRPFMGEVVQALKLI

PatternScan: PS00108
IPR008271
270-282 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDFKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox