PRGDB00071572 (Nta.5107)

From PRG Wiki
Jump to: navigation, search
Nta.5107
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90900943 (DQ447159)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum NAK-type protein kinase mRNA, complete cds

DNA Sequence

ATGCTGAAGTGTTTTTATATATTCAAGGATAAGTCAAGGTCAAGAAGGAGAGGGGAATCGGCACCAGAATTGAGTAATGAAAGTAGGAGAGATGGTAATTCAGAAGGGAAAAAGGTAGCTAAGTCTACAGGTTCAGTTTCATCTGCTAGAAGTATACCGCAAATGTATAGAGAAAAAGAGCAAAATTTGAGGGTTTTTTCACTTTCAGAGCTTAAGGAAGCTACAAGGAGTTTCAATAGGATGTTAAAGATAGGGGAAGGTGGTTTTGGGAGTGTATATAAAGGTACAATTCAGCCTCCTAGTGGAAGAGGTGATCCTATTGTGGTTGCTATTAAGAAGCTCAACACACTTGGATTGCAGGGCCACAGACAATGGGTTGCAGAAGTTCAATTTCTCGGTGTTTTGGAGCACCCTAACCTTGTTAAGCTTCTAGGATATTGCGCTACAGATGGGGAAAGAGGGATTCAGCGCCTATTGGTTTATGAATACATGCAAAATAAGAGCTTAGAAGATCATCTGTTCAACAGAGCTGTGCCGGTAATTCCCTGGAAAACAAGATTGAAAATTATCCTTGGTGCAGCGCAAGGAATGGCTTATTTGCACGAGGGTCTAGAAGTCCAGGTGATATATCGAGATTTCAAGTCATCAAATGTGCTTCTGGATGAGGATTTTAATCCATGGCTTTCAGATTTTGGGCTTGCAAGGGAAGGGCCGGCTGGTGATCGCTCTCATGTGTCTACAGCGCCGGTTGGGACTTTAGGATACGCTGCCCCTGAATATGTTGAAACTGGACATCTATCGGTCAAGAGTGATATTTGGAGCTTTGGAGTTGTTCTTTATGAGATCCTCACTGGCAGACGAACTTTGGAAAGGAACCTTCCCGTGATGCAACAGAAGCTTATTGATTGGGTAAAGCAATTTCCTGCTGATAGTAGAAAATTCAGCATGATCATTGATCCAAGGCTTCGAAACGAGTTCTCACTTGTTGCTGCTAGGAGAATTGCAAAACTGGCCGATAGCTGCTTAAACAAGATCGCCAAAGAGCGTCCAAAAATGAGTGAAGTAGTTCAGATACTAACACAAGCAGTACAAGAATCACAAGAAACAACTTCTTTAGAAATCACAGGTCCAGGTCCAGGGCCATCTCGGCCTACACAGCTTGCCTCACCTAAACAACAACTTAAAAATAAGACCATTGCTGAAACTGCACGGCCAATGCGCCCCATAGCTCAGGCGTGA


Protein sequences

Name Description Sequence
Nta.5107 translated coding region predicted by ESTScan from UniGene Nta.5107

MLKCFYIFKDKSRSRRRGESAPELSNESRRDGNSEGKKVAKSTGSVSSARSIPQMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYMQNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQILTQAVQESQETTSLEITGPGPGPSRPTQLASPKQQLKNKTIAETARPMRPIAQA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF793
1-373 PTHR24420:SF793

MLKCFYIFKDKSRSRRRGESAPELSNESRRDGNSEGKKVAKSTGSVSSARSIPQMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYMQNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQILTQAVQESQETTSLE

HMMPanther: PTHR24420
1-373 PTHR24420,FAMILY NOT NAMED

MLKCFYIFKDKSRSRRRGESAPELSNESRRDGNSEGKKVAKSTGSVSSARSIPQMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYMQNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQILTQAVQESQETTSLE

superfamily: SSF56112
IPR011009
40-359 Kinase_like
Protein kinase-like domain

AKSTGSVSSARSIPQMYREKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYMQNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQIL

Gene3D: G3DSA:3.30.200.20
58-164 G3DSA:3.30.200.20

EKEQNLRVFSLSELKEATRSFNRMLKIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYM

ProfileScan: PS50011
IPR000719
78-363 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNRMLKIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYMQNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQILTQAV

HMMPfam: PF07714
IPR001245
83-359 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KIGEGGFGSVYKGTIQPPSGRGDPIVVAIKKLNTLGLQGHRQWVAEVQFLGVLEHPNLVKLLGYCATDGERGIQRLLVYEYMQNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQIL

PatternScan: PS00107
IPR017441
84-113 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGSVYKGTIQPPSGRGDPIVVAIKK

Gene3D: G3DSA:1.10.510.10
165-358 G3DSA:1.10.510.10

QNKSLEDHLFNRAVPVIPWKTRLKIILGAAQGMAYLHEGLEVQVIYRDFKSSNVLLDEDFNPWLSDFGLAREGPAGDRSHVSTAPVGTLGYAAPEYVETGHLSVKSDIWSFGVVLYEILTGRRTLERNLPVMQQKLIDWVKQFPADSRKFSMIIDPRLRNEFSLVAARRIAKLADSCLNKIAKERPKMSEVVQI

PatternScan: PS00108
IPR008271
208-220 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox