PRGDB00071573 (Nta.5114)

From PRG Wiki
Jump to: navigation, search
Nta.5114
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 94494361 (DQ460051)
Gene Class N
Domain Type NBS
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum cDNA-AFLP fragment H-N_BC1M11-260 sequence

DNA Sequence

AGACATCACTAGACAAAGTATCCATGCTAATTTGCTCATTACCCATTGTCATGGCAACACTTTTCTTACGTGTCGTCACAATGATCTTACTTCCAATTTCTCCTTGTGCAAAAGGATTTATCAACTCAACCCACTCGAGGTAGTTGTCATTCCAAACATCATCTAAAACAATAAGAAACTTTTTCCCTTTTACTCAGGACTCATC


Protein sequences

Name Description Sequence
Nta.5114 translated coding region predicted by ESTScan from UniGene Nta.5114

DESXVKGKKFLIVLDDVWNDNYLEWVELINPFAQGEIGSKIIVTTRKKSVAMTMGNEQISMDTLSSDVX

Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
4-67 NB-ARC,NBS
NB-ARC

XVKGKKFLIVLDDVWNDNYLEWVELINPFAQGEIGSKIIVTTRKKSVAMTMGNEQISMDTLSSD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox