PRGDB00071577 (Nta.5353)

From PRG Wiki
Jump to: navigation, search
Nta.5353
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83420673 (DW002667)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KR3B.103J08F.051108T7 KR3B Nicotiana tabacum cDNA clone KR3B.103J08, mRNA sequence

DNA Sequence

GGGGTGGAGGTTTTGGTTCTGTTTTCAAAGGGAAACTATCTGATTCATCTGTTATTGCGGTTAAGAGGCTCGATAGCATCAACCAGGGAGAGAAGCAATTTCGAACAGAAGTCAGCACAATCGGGACAATCCAACATGTTAATCTTGTACGCCTTCGTGGATTTTGCTCTGAAGGTAACAAGAAGCTGCTGGTTTATGATTACATGGAAAATGGTTCCTTGGATTCACATCTTTTTACCGAGAAGCAGTCAGATGTAATGGATTGGAAAACAAGGTACCAGGTGGCGCTGGGGACAGCTAGAGGCTTGACTTATCTCCATGAGAAGTGCAGGGACTGCATTATACACTGTGACATAAAGCCTGAAAACATCCTTCTTGATGCACAACTATGCCCCAAAGTAGCAGATTTTGGCCTGGCAAAGCTTGTTGGGCGCGACTTTAGCAGAGTGCTTACTACTATGAGAGGAACAAGAGGTTATCTTGCACCTGAATGGATATCAGGGGTGGCCATTACAGCCAAAGCTGATGTTTATAGCTATGGCATGATGCTTTTGGAAATCGTATCAGGGAGGCGAAACTCGGAGCAGTCTCAAGATGGAAAAGTGAAATTCTTCCCTAGTTGGGCTTCACGTGTATTAGCTGATGAAGGCGACATTCTTAGCCTATTGGACTATAGGCTGGACAGAGTTGCTGACGCTGAGGAGGTGTCAAGAATCTGTAAAGTTGCTTGTTGGTGTATCCAAGATGATGAATTACAAAGGCCCTCGATGGGGCAGGTTGTTCAGATTCTTGAAGGAGTTTTGGAGGTGAATTTGCCTCCTATCCCACGCTCTCTTCAAGTTTATGCAGACAACGATGGGCACATAGTGTTCTTCACTGAGTCATCCTCGAGCCAGACTAGTTCACAAGCTCAGAGCAAGACTTCAAGTGCAACATCTCAATCCAAAAGCACCAC


Protein sequences

Name Description Sequence
Nta.5353 translated coding region predicted by ESTScan from UniGene Nta.5353

XGGGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQILEGVLEVNLPPIPRSLQVYADNDGHIVFFTESSSSQTSSQAQSKTSSATSQSKSTT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGGGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQILEGVL

Seg: seg
1-12 seg

XGGGFGSVFKGK

HMMPanther: PTHR24420:SF442
2-286 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GGGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQILEGVLEVNLPPIPRSLQVYADND

HMMPanther: PTHR24420
2-286 FAMILY NOT NAMED,FAMILY NOT NAMED

GGGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQILEGVLEVNLPPIPRSLQVYADND

HMMSmart: SM00219
IPR020635
2-264 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GGGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQIL

HMMPfam: PF00069
IPR017442
3-262 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQ

Gene3D: G3DSA:3.30.200.20
3-70 no description

GGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYME

superfamily: SSF56112
IPR011009
3-295 Protein kinase-like (PK-like)
Protein kinase-like domain

GGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQILEGVLEVNLPPIPRSLQVYADNDGHIVFFTES

HMMSmart: SM00220
IPR002290
3-263 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GGFGSVFKGKLSDSSVIAVKRLDSINQGEKQFRTEVSTIGTIQHVNLVRLRGFCSEGNKKLLVYDYMENGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQI

Gene3D: G3DSA:1.10.510.10
71-303 no description

NGSLDSHLFTEKQSDVMDWKTRYQVALGTARGLTYLHEKCRDCIIHCDIKPENILLDAQLCPKVADFGLAKLVGRDFSRVLTTMRGTRGYLAPEWISGVAITAKADVYSYGMMLLEIVSGRRNSEQSQDGKVKFFPSWASRVLADEGDILSLLDYRLDRVADAEEVSRICKVACWCIQDDELQRPSMGQVVQILEGVLEVNLPPIPRSLQVYADNDGHIVFFTESSSSQTSSQ

PatternScan: PS00108
IPR008271
114-126 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPENILL

Seg: seg
295-319 seg

SSSSQTSSQAQSKTSSATSQSKSTT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox