PRGDB00071580 (Nta.5852)

From PRG Wiki
Jump to: navigation, search
Nta.5852
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76870394 (DV161386)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KP1B.107P09F.050726T7 KP1B Nicotiana tabacum cDNA clone KP1B.107P09, mRNA sequence

DNA Sequence

GGCCATTACGGCCggggggggggatcaatttgaatttgactaaatttcatttttattttttctctcattttcaactttcccaattcatttttggaccctctggatctaacccttgtctgagaaattttcaagatttgattctttttgttcattttgtattgtggattgtaatatttgtttAATTTGATTGCTATGGATGATAATTTTCACAGGCAAGGGCTAGTGGCACATGCTCCTCCTCCTGGTCACTTTTCACGGTTGGAAAACAGAAGGGCTGAAGACGATCTTTATTTGAGAAAGAGAGTGAGGATGAGAAGGTGGCTGTGCTGCACCTGTCAAGTAGAGGAATCCTACCCATCAAATGAAACTGAGCACCTTAAAAACCCTGCAACTCATGCTGATGGATATCAGAACGGGTCAAGAGTACCAGCTCCTGCCAAGGCTGAAGCAGAAAAAGCAATACCAACTATAGAGGTCCCAGCATTGTCTTTGGATGAACTGAAAGAGGAAACTGACAATTTTGGATCAAAAGCATTAATTGGTGAAGGTTCTTACGGGAGAGTATACTATGCTAATCTAAGCAATGAAAAAGCTGTTGCCGTGAAAAAGCTTGATGTTTCATCCGAGCCTGAGACTAATGTTGACTTCTTGACTCAGCTTGCTAGAGTTTCAAGATTGAAGCATGACAATCTTGTTGAGTTGCTTGGTTACTGTGTTGAAGGAAATATTCGTGTATTAGCGTATGAATTTGCAACGATGGGGTCCTTGCATGATATTTTGCACGGAAGGAAAGGAGTACAAGGGGCGCAGCCGGGGCCAACACTTGATTGGATGCAGCGGGTAAAGATTGCTGTTGATGCCGCAAGGGGACTCGAGTATTTGCATGAGAAGGTCCAACCTTCAATAATACACAGGGA


Protein sequences

Name Description Sequence
Nta.5852 translated coding region predicted by ESTScan from UniGene Nta.5852

MDDNFHRQGLVAHAPPPGHFSRLENRRAEDDLYLRKRVRMRRWLCCTCQVEESYPSNETEHLKNPATHADGYQNGSRVPAPAKAEAEKAIPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHRX

Domains

Domain Start-End Description Sequence

Seg: seg
79-89 seg

PAPAKAEAEKA

HMMPanther: PTHR24420:SF416
82-241 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AKAEAEKAIPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHR

HMMPanther: PTHR24420
82-241 FAMILY NOT NAMED,FAMILY NOT NAMED

AKAEAEKAIPTIEVPALSLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHR

Gene3D: G3DSA:3.30.200.20
95-173 no description

VPALSLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGY

superfamily: SSF56112
IPR011009
99-241 Protein kinase-like (PK-like)
Protein kinase-like domain

SLDELKEETDNFGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHR

ProfileScan: PS50011
IPR000719
110-242 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHRX

HMMSmart: SM00219
IPR020635
110-242 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FGSKALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHRX

HMMPfam: PF07714
IPR001245
114-241 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ALIGEGSYGRVYYANLSNEKAVAVKKLDVSSEPETNVDFLTQLARVSRLKHDNLVELLGYCVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHR

PatternScan: PS00107
IPR017441
116-139 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYANLSNEKAVAVKK

Gene3D: G3DSA:1.10.510.10
174-241 no description

CVEGNIRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWMQRVKIAVDAARGLEYLHEKVQPSIIHR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox