PRGDB00071582 (Nta.6193)

From PRG Wiki
Jump to: navigation, search
Nta.6193
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76867921 (DV158914)
Gene Class Unknown
Domain Type LRR
Gene Species Nicotiana tabacum

Comment?

KG9B.004P01F.050721T7 KG9B Nicotiana tabacum cDNA clone KG9B.004P01, mRNA sequence

DNA Sequence

GAGTCTTCCTTTCCCTTTTTCTTCTTCATCTGGGTCTACTCCCTACAAATTATCTCACCTCAAAATCTAATATTTCAGCTTTTGTGTAGAAAGAACCATGGCAACTGTTATTGAAACCCAGAGTTTGGGCTTTTTGGTAATTGTACTTGCTCTAGCTGTTAGTGTTAGGGGAAATTCAGAAGGGGATGCTTTGTACGCCCTCCGTCGGAGCTTATCCGACCCGGATAACGTGCTCCAGAGCTGGGATCCGAATCTTGTAAACCCTTGTACTTGGTTTCATGTTACTTGCAACGGCGATAACCACGTCACTCGTGTGGACCTTGGCAACTCAAAGCTATCTGGTCATTTGGTACCTGAACTTGGAAAGCTCGAACATCTACAGTATTTGGAGCTTTACAAAAATAATATTCAGGGAACCATCCCTAAAGAGCTTGGTAACTTGAAGAGCCTTATCAGTCTGGATCTGTACAACAATAATATTTCAGGGACAATCCCTCCTTCACTGGGAAAGTTGAAAAATCTTGTTTTCCTGCGTCTGAATGATAACCAGCTAACTGGACCAATCCCAAGAGAACTTTCTAGTGTTTCTAGCCGAAAGTTGTGGATGTCTCAAATAACAATTTGTGTGGAACAATTCCTACTTCTGGTCCATTTGAGCATATTCCACTGAACAACTTTGAGCACAATCCTCGACTTGAAGGTCCGGAGTTGTTGGGACTCGCCAGCTATGACACCAATTGCTCTTAGGAAAGTTGATGAATAGGCTGAGAAGAACAGCCGCTTTTTGTGGAAGTTCACATAAATCCCTTCCCTGAATGTTGGTTATGATTGTACTTACTATGTGTCCAAGTTGTAATTGTAAGGAAAGATATGATGTATGTAGGATATTAGTAAGTTAATGAATGTGTGTAAAACGGTCAATATACTGCTACCAAGTGCTAATGTATTTTATATTTCA


Protein sequences

Name Description Sequence
Nta.6193 translated coding region predicted by ESTScan from UniGene Nta.6193

MATVIETQSLGFLVIVLALAVSVRGNSEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTCNGDNHVTRVDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPPSLGKLKNLVFLRLNDNQLTGPIPRELSSVSSXKVVDVSNNNLCGTIPTSGPFEHIPLNNFEHNPRLEGPELLGLASYDTNCS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF836
1-204 SUBFAMILY NOT NAMED

MATVIETQSLGFLVIVLALAVSVRGNSEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTCNGDNHVTRVDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPPSLGKLKNLVFLRLNDNQLTGPIPRELSSVSSXKVVDVSNNNLCGTIPTSGPFEHIPLNNFEHNPRLEGPE

HMMPanther: PTHR24420
1-204 FAMILY NOT NAMED,FAMILY NOT NAMED

MATVIETQSLGFLVIVLALAVSVRGNSEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTCNGDNHVTRVDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPPSLGKLKNLVFLRLNDNQLTGPIPRELSSVSSXKVVDVSNNNLCGTIPTSGPFEHIPLNNFEHNPRLEGPE

superfamily: SSF52058
22-209 L domain-like,LRR

SVRGNSEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTCNGDNHVTRVDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPPSLGKLKNLVFLRLNDNQLTGPIPRELSSVSSXKVVDVSNNNLCGTIPTSGPFEHIPLNNFEHNPRLEGPELLGLA

HMMPfam: PF08263
IPR013210
26-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
27-183 no description

SEGDALYALRRSLSDPDNVLQSWDPNLVNPCTWFHVTCNGDNHVTRVDLGNSKLSGHLVPELGKLEHLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNISGTIPPSLGKLKNLVFLRLNDNQLTGPIPRELSSVSSXKVVDVSNNNLCGTIPTS

HMMPfam: PF12799
93-129 LRR_4,Leucine Rich repeats (2 copies)

HLQYLELYKNNIQGTIPKELGNLKSLISLDLYNNNIS

HMMPfam: PF13516
139-161 LRR_6,Leucine Rich repeat

LKNLVFLRLNDNQLTGPIPRELS

Seg: seg
161-175 seg

SSVSSXKVVDVSNNN

HMMPfam: PF00560
IPR001611
168-183 LRR_1
Leucine-rich repeat

VVDVSNNNLCGTIPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox