PRGDB00071584 (Nta.6500)

From PRG Wiki
Jump to: navigation, search
Nta.6500
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 94327283 (EB680885)
Gene Class Mlo-like
Domain Type MLO
Gene Species Nicotiana tabacum

Comment?

KL4B.111K19F.060128T7 KL4B Nicotiana tabacum cDNA clone KL4B.111K19, mRNA sequence

DNA Sequence

TTCCGTGCAAATAAGTTTTCCCTATCTGCTATAATAATTAAAGATGGTACTCCTCTTCCTTGAAGAAAAACCCGTGTAGTCACAGTCGAGTAGTCGCCACACTAGACTAGTTGTTGTGGCTTCCATTTTTGCCATCGGCGATTCATCTTTGTGAAGTAAAGAGAAATGAGTGGTGGTGGAGAAGGGGAAGGTTCTACATTGGAATTCACACCTACTTGGGTGGTGGCCGCCGTCTGCACCGTCATCGTTGCCATCTCTCTTGCCGCTGAACGCTTCCTCCATTTCCTTGGAAAGTATCTGAAGAAGAAGAATCAGAAGCCTTTATATGAAGCCCTACAGAAAGTTAAAGAAGAGTTGATGCTTTTGGGGTTTATATCCCTGTTATTAACGGTGCTTCAAGGTAGCATAGTCAAGATTTGTGTCCCTGAAGATGTTGTCATGCACTTACTTCCATGTTCATTATCGGAGGCTCCTTCGTCTTCTGCCAATGAAACTGCTCATGCTAGTCCTGGATCTGAACATCATCGCCGTTTGTTAGCTGAAGAAGCAGCTGCTGCTGGCTATTGCAGTGCAAAACACAAGGTCCCACTACTCTCTCTTGAAGCGTTGCATCACCTTCACATTTTTATCTTTGTTCTTGCGATTGTTCATGTGACTTTCTCTCTTCTGACAGTTGTATTTGGAGGAGCAAAGATACGTCAGTGGAAGCACTGGGAGGACAGCATTGCAAAAGATAATTATGAGACTGGACGTGTTCTAAAACCACCGGTCACACATGTCCAGCAACACGATTTCATCAGGGACCGATTTGTCGGCATGGGCAAACGTTCAGCCATTTCTGGTTGGTTGCACTCTTTTTTTAAGCAATTTTATGGTTCTGTCAGCAAGTCGGATTATGCTGCCCTGCGTTTGGGGTTCATTATGACACA


Protein sequences

Name Description Sequence
Nta.6500 translated coding region predicted by ESTScan from UniGene Nta.6500

MSGGGEGEGSTLEFTPTWVVAAVCTVIVAISLAAERFLHFLGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVLQGSIVKICVPEDVVMHLLPCSLSEAPSSSANETAHASPGSEHHRRLLAEEAAAAGYCSAKHKVPLLSLEALHHLHIFIFVLAIVHVTFSLLTVVFGGAKIRQWKHWEDSIAKDNYETGRVLKPPVTHVQQHDFIRDRFVGMGKRSAISGWLHSFFKQFYGSVSKSDYAALRLGFIMTX

Domains

Domain Start-End Description Sequence

Seg: seg
2-10 seg

SGGGEGEGS

HMMPfam: PF03094
IPR004326
8-254 Mlo
Mlo-related protein

EGSTLEFTPTWVVAAVCTVIVAISLAAERFLHFLGKYLKKKNQKPLYEALQKVKEELMLLGFISLLLTVLQGSIVKICVPEDVVMHLLPCSLSEAPSSSANETAHASPGSEHHRRLLAEEAAAAGYCSAKHKVPLLSLEALHHLHIFIFVLAIVHVTFSLLTVVFGGAKIRQWKHWEDSIAKDNYETGRVLKPPVTHVQQHDFIRDRFVGMGKRSAISGWLHSFFKQFYGSVSKSDYAALRLGFIMT

Seg: seg
19-30 seg

VVAAVCTVIVAI

Seg: seg
118-131 seg

EHHRRLLAEEAAAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox