PRGDB00071589 (Nta.6854)

From PRG Wiki
Jump to: navigation, search
Nta.6854
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 60265615 (AY911854)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum cinnamyl alcohol dehydrogenase 1 (CAD1-1) mRNA, complete cds

DNA Sequence

ATGGCGACGAAAACAGTATGTGTAACAGGATCTTCAGGCTACATAGCTTCATGGTTAGTGAAGTTTCTGCTCCAGCGTGGTTATACCGTTAAGGCCACTGTTCGCGATCCCAGTGATCCAAAGAAGACAGATCACTTACATTCCCTTAGTGGAGCTAAGGAGAGGCTTCACTTGTTCAAAGCGAACCTTCTGGAAGAAGGTGCCTTTGATGCTGTGGTTGATGGGTGTGAAGGCGTATTTCATACAGCATCTCCATTTTACCATGGAGTCAAAGATCCACAGGCAGAATTAATTGATCCTGCACTGAAGGGGACACTTAATGTTCTTGGATCAGTTGCAAAGACGCCATCAATTAGAAGAGTGGTTTTGACATCATCTGTAGCAGCAGTTGCTTTCAATGGAAAACCGCGAACCCCTGAAGTGGTAGTTGATGAGACATGGGGGTCGGATCCTGACTTTTGCAGAGAATCACAGCTCTGGTATGTACTTTCGAAGACATTGGCTGAGGATGCTGCATGGAAGTTTGTGAAAGAGAAAGCTATCGATATGGTTACGATAAACCCAGCAATGGTTATTGGCGGTTTGTTACAACCAATACTTAATACAAGTTGCGCTGCTGTCTTACAACTGATAAATGGTGCTGAAACATACCCAAATGCTACACTTGGATGGGTTAATGTGAAAGATGTTGCCCTCGCGCATATTCTAGCATTTGAAAACCCTTCAGCTAATGGTAGATATTTAATGGTTGAGGCAGTTGCACACTACTCTGAGTTAGTGAAGATATTACGCGAGCATTATCCCACAATGAAGCTTCCAGAAAAGTGTGTTGATGATAAGCCATTTCCTCCGAAGTACCAGGTTAACATAGAAAGAGCAAAGCAATTGGGTGTTGAGTTCACTCCCTTGGCTGAAAGCATCAAAGAAACTGTCGAAAGCTTGAAGGAGAAAAAATTCTATTCAGATGCTTAG


Protein sequences

Name Description Sequence
Nta.6854 translated coding region predicted by ESTScan from UniGene Nta.6854

MATKTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFKANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKAIDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFENPSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEFTPLAESIKETVESLKEKKFYSDA

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.720
IPR016040
4-230 NAD(P)-bd
NAD(P)-binding domain

KTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFKANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKAIDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDV

superfamily: SSF51735
4-316 NAD(P)-bd

KTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFKANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKAIDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFENPSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEFTPLAESIKETVESLKE

HMMPanther: PTHR10366:SF9
4-317 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

KTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFKANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKAIDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFENPSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEFTPLAESIKETVESLKEK

HMMPanther: PTHR10366
4-317 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

KTVCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFKANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKAIDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFENPSANGRYLMVEAVAHYSELVKILREHYPTMKLPEKCVDDKPFPPKYQVNIERAKQLGVEFTPLAESIKETVESLKEK

HMMPfam: PF01370
IPR001509
6-247 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGSSGYIASWLVKFLLQRGYTVKATVRDPSDPKKTDHLHSLSGAKERLHLFKANLLEEGAFDAVVDGCEGVFHTASPFYHGVKDPQAELIDPALKGTLNVLGSVAKTPSIRRVVLTSSVAAVAFNGKPRTPEVVVDETWGSDPDFCRESQLWYVLSKTLAEDAAWKFVKEKAIDMVTINPAMVIGGLLQPILNTSCAAVLQLINGAETYPNATLGWVNVKDVALAHILAFENPSANGRY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox