PRGDB00071590 (Nta.7077)

From PRG Wiki
Jump to: navigation, search
Nta.7077
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 254628368 (FS411151)
Gene Class Unknown
Domain Type LRR
Gene Species Nicotiana tabacum

Comment?

FS411151 normalized full-length tobacco cDNA library Nicotiana tabacum cDNA clone TBK02GR0029_1_D12 5', mRNA sequence

DNA Sequence

GAGTAAAGGAAAAATGAGGTTCGTTGGCTTGGTGTTCCTAGTTGGTGCGCTGGCCATTATAGCTGCAGAATGCAACTCTGAAGGGGATGCTCTTAATGCATTCAAAGTTAACGTGGTAGACCCAAACAATGTTCTTCAGAGCTGGGACCCGACGTTAATCAATCCTTGCACATGGTTTCATGTCACCTGCAACGGCGAAAATACTGTTGTAAGAGTGGACCTAGGTGCTGCTAATCTTACCGGGACACTGGTACCTCAGTTGGGAATGCTAGCCAATCTTCAATACTTGCAACTTGAAAATAATTCATTTAGCGGAGCAATCCCAAGCCAATTAGGCAACTTGACAAGGCTAGTGAGTTTGGGATTAGACAATAACAAGCTGAGTGGCCCTATCCCATCATCTCTTGGCAATTTAATATCTTTGCGATGGATGAGATTGAACGGTAATAAATTATCAGGGAAAATTCCAATCTCAGTCTTGAAGCTCATCTACTGGGGAAATTTGCAGCTACTGAATGTTTCAGACAATAAACTAGCAGGGACTGTCCATCGTGCTAACCAAACAGGATTTGCAATTACAACAATTGTTCAAGACGTCAAGGCCTAGATCAGGTTACTTGATCAAC


Protein sequences

Name Description Sequence
Nta.7077 translated coding region predicted by ESTScan from UniGene Nta.7077

XSKGKMRFVGLVFLVGALAIIAAECNSEGDALNAFKVNVVDPNNVLQSWDPTLINPCTWFHVTCNGENTVVRVDLGAANLTGTLVPQLGMLANLQYLQLENNSFSGAIPSQLGNLTRLVSLGLDNNKLSGPIPSSLGNLISLRWMRLNGNKLSGKIPISVLKLIYWGNLQLLNVSDNKLAGTVHRANQTGFAITTIVQDVKA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
6-183 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MRFVGLVFLVGALAIIAAECNSEGDALNAFKVNVVDPNNVLQSWDPTLINPCTWFHVTCNGENTVVRVDLGAANLTGTLVPQLGMLANLQYLQLENNSFSGAIPSQLGNLTRLVSLGLDNNKLSGPIPSSLGNLISLRWMRLNGNKLSGKIPISVLKLIYWGNLQLLNVSDNKLAGTV

HMMPanther: PTHR24420
6-183 FAMILY NOT NAMED,FAMILY NOT NAMED

MRFVGLVFLVGALAIIAAECNSEGDALNAFKVNVVDPNNVLQSWDPTLINPCTWFHVTCNGENTVVRVDLGAANLTGTLVPQLGMLANLQYLQLENNSFSGAIPSQLGNLTRLVSLGLDNNKLSGPIPSSLGNLISLRWMRLNGNKLSGKIPISVLKLIYWGNLQLLNVSDNKLAGTV

superfamily: SSF52058
22-181 L domain-like,LRR

AAECNSEGDALNAFKVNVVDPNNVLQSWDPTLINPCTWFHVTCNGENTVVRVDLGAANLTGTLVPQLGMLANLQYLQLENNSFSGAIPSQLGNLTRLVSLGLDNNKLSGPIPSSLGNLISLRWMRLNGNKLSGKIPISVLKLIYWGNLQLLNVSDNKLAG

HMMPfam: PF08263
IPR013210
26-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGDALNAFKVNVVDPNNVLQSWDPTLINPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
27-183 no description

SEGDALNAFKVNVVDPNNVLQSWDPTLINPCTWFHVTCNGENTVVRVDLGAANLTGTLVPQLGMLANLQYLQLENNSFSGAIPSQLGNLTRLVSLGLDNNKLSGPIPSSLGNLISLRWMRLNGNKLSGKIPISVLKLIYWGNLQLLNVSDNKLAGTV

HMMPfam: PF12799
93-130 LRR_4,Leucine Rich repeats (2 copies)

NLQYLQLENNSFSGAIPSQLGNLTRLVSLGLDNNKLSG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox