PRGDB00071602 (Nta.8360)

From PRG Wiki
Jump to: navigation, search
Nta.8360
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76871061 (DV162053)
Gene Class Unknown
Domain Type LRR
Gene Species Nicotiana tabacum

Comment?

KP1B.109P14F.050727T7 KP1B Nicotiana tabacum cDNA clone KP1B.109P14, mRNA sequence

DNA Sequence

AAATAAAAACTTGTCGTCTTCACGACATGTTGCATCAGTTCTGCAAAAAGGAGGCTAGTAACAAATGGCTTTTTCAAGAAGTCTGTCTAACTCCTGATCAAACTATTCCTATGGAAGACCCAAATAAATCTCGTCGATTGTGCATTCAACCCTCTAATCTGAAAGACTTTCTCTCCAAAAAACCTTCTGCAGAACATGTTAGATCTTTCTATTGTTTTTCCTCAAAAGAAAAACAAATCAGCGGTTGACTCCTAATGACATTAAACTCATCCACAAAGCATTTCCGCTTGTCAGGGTTTTGGACGTTGAATCCCTCAAGTTTCTCTTCTCTAAGGATTTTAACCAGTTATTTCATTTGAGATATATTGCTATCTCAGGTGACTTCAATGCCATTCCTTTGACCTTTGGTAAATTTTGGAATTTACAAACTCTTATTCTTAATACGAGTACCTCAGAGTCCACCCTTGATGTAAAAGCAGACATATGGAACATGTTACAGTTGAGGCATCTTCACACCAACATACCTGCAAAATTGCAACCCCCTACTGCGACGACATCAGGTAAAGCTTCTTGTCTACAAACTCTTTGTATGGTTGCACCAGAAAGTTGTGAGAAAGAAGTGCTCGCAAAGGCTTGTCATCTGAAAAAATTGAGCATTCGAGGACAAATGGCAGCTTTTCTTGGTGCTTACAAGGGTGGAATCAACAATCTTGAAGAGCTAAAGTGCTTGGAACAATTGAAATTGTTGAATGATGTTCTTTACATGAATAAAGCGCCCCACCTCCCTCCAACATTCTCCCAACTTGTACGTACTGTGAAGAAGTTAACTTTGACAAATACAAGGTTTGCTTGGAGTGAGGC


Protein sequences

Name Description Sequence
Nta.8360 translated coding region predicted by ESTScan from UniGene Nta.8360

XIKTCRLHDMLHQFCKKEASNKWLFQEVCLTPDQTIPMEDPNKSRRLCIQPSNLKDFLSKKPSAEHVRSFYXFFLKRKTNQRLTPNDIKLIHKAFPLVRVLDVESLKFLFSKDFNQLFHLRYIAISGDFNAIPLTFGKFWNLQTLILNTSTSESTLDVKADIWNMLQLRHLHTNIPAKLQPPTATTSGKASCLQTLCMVAPESCEKEVLAKACHLKKLSIRGQMAAFLGAYKGGINNLEELKCLEQLKLLNDVLYMNKAPHLPPTFSQLVRTVKKLTLTNTRFAWSEA

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
6-283 L domain-like,LRR

RLHDMLHQFCKKEASNKWLFQEVCLTPDQTIPMEDPNKSRRLCIQPSNLKDFLSKKPSAEHVRSFYXFFLKRKTNQRLTPNDIKLIHKAFPLVRVLDVESLKFLFSKDFNQLFHLRYIAISGDFNAIPLTFGKFWNLQTLILNTSTSESTLDVKADIWNMLQLRHLHTNIPAKLQPPTATTSGKASCLQTLCMVAPESCEKEVLAKACHLKKLSIRGQMAAFLGAYKGGINNLEELKCLEQLKLLNDVLYMNKAPHLPPTFSQLVRTVKKLTLTNTRF

Seg: seg
236-251 seg

NNLEELKCLEQLKLLN

Gene3D: G3DSA:3.80.10.10
255-283 no description

YMNKAPHLPPTFSQLVRTVKKLTLTNTRF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox