PRGDB00071617 (Nta.9717)

From PRG Wiki
Jump to: navigation, search
Nta.9717
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83421000 (DW002994)
Gene Class Unknown
Domain Type LRR
Gene Species Nicotiana tabacum

Comment?

KR3B.104I08F.051108T7 KR3B Nicotiana tabacum cDNA clone KR3B.104I08, mRNA sequence

DNA Sequence

TATGAAGAATTAGGGCAGCAACCACGATAAAATTTACGGAAGATGAGGTCCGTCGCTCTTGTTTTCTTGGTTGGTGCAATTGCCTTTATATCTGCAGAATGCAACTCTGAAGGGGACACTCTTTACGCATGGAAAACTAACCTGATAGATCCAAACAATGTGCTTCAAACCTGGGATCCGACGTTAGTCAATCCTTGCACATGGTTTCATGTCACCTGCAACGGCCAGAATAGCGTTGTAAGAGTGGACCTAGGTGCTGCTAACCTCTCTGGGATTCTGGTACCTCAATTGGGAACGCTAAGCAATCTTCAATACTTGCAACTTCAAAATAACTCAATTAGCGGAGAAATCCCAAGCCAATTAGGCAACTTGACAAAGCTAGTGAGCTTGGGGCTGGAAAATAATCAGCTGAGTGGCCATATTCCATCATCTCTTGGCAATTTAAAATCCCTACAGTGGATGAGATTGGACGGTAATAAATTATCAGGGATCATTCCAATTGCAGTCTTGAAGCTCGTCTACTGGGGAAATTTGCAGCTACTGAATGTGTCCAACAATCAATTGGCAGGGACTGTCCACCACACTAACAAAGCAGGATTTGCTACTACAACTATAATTCAAGACTTGATCACTTGATTGACCATTTGAGCTGGATAGTCCTGTGAAGCTGCACTTTGGTATATGTACAAGTCTATTAAGATTTGGAGTAAAATAATCACTCTGTAATAACAATGGTTCTTATATTGTATTTCCAAAACACTTATTTTGTGCCTTTCAATTGACATTATTGATC


Protein sequences

Name Description Sequence
Nta.9717 translated coding region predicted by ESTScan from UniGene Nta.9717

YEELGQQPRXNLRKMRSVALVFLVGAIAFISAECNSEGDTLYAWKTNLIDPNNVLQTWDPTLVNPCTWFHVTCNGQNSVVRVDLGAANLSGILVPQLGTLSNLQYLQLQNNSISGEIPSQLGNLTKLVSLGLENNQLSGHIPSSLGNLKSLQWMRLDGNKLSGIIPIAVLKLVYWGNLQLLNVSNNQLAGTVHHTNKAGFATTTIIQDLIT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
1-192 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YEELGQQPRXNLRKMRSVALVFLVGAIAFISAECNSEGDTLYAWKTNLIDPNNVLQTWDPTLVNPCTWFHVTCNGQNSVVRVDLGAANLSGILVPQLGTLSNLQYLQLQNNSISGEIPSQLGNLTKLVSLGLENNQLSGHIPSSLGNLKSLQWMRLDGNKLSGIIPIAVLKLVYWGNLQLLNVSNNQLAGTV

HMMPanther: PTHR24420
1-192 FAMILY NOT NAMED,FAMILY NOT NAMED

YEELGQQPRXNLRKMRSVALVFLVGAIAFISAECNSEGDTLYAWKTNLIDPNNVLQTWDPTLVNPCTWFHVTCNGQNSVVRVDLGAANLSGILVPQLGTLSNLQYLQLQNNSISGEIPSQLGNLTKLVSLGLENNQLSGHIPSSLGNLKSLQWMRLDGNKLSGIIPIAVLKLVYWGNLQLLNVSNNQLAGTV

superfamily: SSF52058
31-190 L domain-like,LRR

SAECNSEGDTLYAWKTNLIDPNNVLQTWDPTLVNPCTWFHVTCNGQNSVVRVDLGAANLSGILVPQLGTLSNLQYLQLQNNSISGEIPSQLGNLTKLVSLGLENNQLSGHIPSSLGNLKSLQWMRLDGNKLSGIIPIAVLKLVYWGNLQLLNVSNNQLAG

HMMPfam: PF08263
IPR013210
35-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGDTLYAWKTNLIDPNNVLQTWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
36-193 no description

SEGDTLYAWKTNLIDPNNVLQTWDPTLVNPCTWFHVTCNGQNSVVRVDLGAANLSGILVPQLGTLSNLQYLQLQNNSISGEIPSQLGNLTKLVSLGLENNQLSGHIPSSLGNLKSLQWMRLDGNKLSGIIPIAVLKLVYWGNLQLLNVSNNQLAGTVH

Seg: seg
100-114 seg

LSNLQYLQLQNNSIS

HMMPfam: PF12799
102-138 LRR_4,Leucine Rich repeats (2 copies)

NLQYLQLQNNSISGEIPSQLGNLTKLVSLGLENNQLS

Seg: seg
177-188 seg

NLQLLNVSNNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox