PRGDB00071618 (Nta.9892)

From PRG Wiki
Jump to: navigation, search
Nta.9892
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 121308606 (AB110955)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

Nicotiana tabacum NtPERK1 mRNA for PERK1-like protein kinase, complete cds

DNA Sequence

ATGTCCTCTCCGACGCCGGGAGCTTCCCCTGCTCCCACATCGCCTCCGGCGCCTCCTACTAACTCTACTTCTCCGCCGCCAACTGCGGTGGCCTCACCACCAGCTCTTCCTGCACAAGCTCCTCCTCCTACTAGCCCTACGCCACCGGCCACCACTCCTCCGCccacggcctctgcctctcctccaccaccttccacctctgctccttcctcctccaccccaccTCCACCAACAACACAATCAACCCCAGAACCATCTGGGTCTCCTCCTTCGCCACCTTCTCCGCCGTCTGGTTCTTCGCCTTCACCGCCGGCACCTTCAGGGTCAGGGAGGTCTCCGGCGGGTCCTAGAGGAGGAGGAGGTTCGTCGACTTCCTCACCGGCGTCAGATGAAGGGTCCTCGGGCGTATCGACCGGACTGGTGGTGGGAATAGCCATTGGGGGCGTTCTGATTCTGGCAGTGTTGAGTTTGTTGTTCATATGTTGCAGCAGGAGGAAGAAGAGGAGAAATCATGGTCCAGTTGAGTACTATCCTCCTGCACAACCACCACCTATGGGGTATAAAGCTGACCCTTATGGTGACCCTGTGCACCATTGGCAACATAATGCTCCATCACCTGCCGATCATGTTGTTTCAATTCCACCAAAACCATCTCCGCCACCTGCAGGGGCTTCACGACCTCCACACTCTCCAGTTACCGCTTCTTCACTTCAACCTCCTCCGCCTCCACCTTACATGAGCAGCAGTGGAGCTTCGTCCAATTATTCGGGGTTTGATCCACTTCCACCACCTTCTCCTGGAATGGTTTTAGGATTCTCAAAGAGCACATTCACATATGAGGAATTGGTGCGGGCAACTGATGGCTTCTCCAATGCTAACCTTCTCGGACAAGGTGGTTTTGGCTATGTGCATAGAGGGGTCCTTCCTAATGGCAAAGAGGTTGCAGTCAAACAGCTAAAAGCTGGAAGTGGACAGGGTGAGCGTGAATTCCAAGCAGAGGTTGAGATCATTAGCCGAGTACATCACAAACATCTTGTTTCTCTAGTTGGATACTGCATAACTGGGTCCCAGAGACTGCTTGTCTACGAGTTTGTTCCAAATAACACCTTGGAATTCCACTTACATGGAAAGGGAAGGCCTCCATTGGATTGGCCCATCCGACTGAAGATTGCTCTAGGATCTGCTAAAGGACTGGCATATTTGCATGAAGACTGTCAACCTAAAATCATTCATCGAGATATCAAGGCAGCAAATATACTTGTTGACTTTAACTTTGAGGCTAAGGTTGCCGATTTTGGACTTGCGAAGTTAACATCTGATGTTAATACTCATGTCTCTACTAGAGTGATGGGAACTTTTGGGTATTTGGCTCCTGAATATGCTTCTTCTGGAAAACTTACGGAGAAGTCTGATGTATTCTCCTATGGAATAATGCTTCTAGAGTTGATCACCGGACGTCGGCCTGTTGACTCTAGTCAAACATACATGGATGATAGTTTAGTTGACTGGGCAAGGCCTCAGCTTACACGAGCTCTTGAAGACGAGAAGTTTGATTCCCTAATTGATCCACGTTTAGGAAATGATTATAACCATAATGAGGTAGCTCGGATGGTTGCTTGTGCTGCTGCTTGTGTCCGTCATTCAGCAAGGCGTCGACCACGCATGAGTCAGGTTGTCAGAGCTCTGGAAGGAGACGTGTCATTGTCCGATCTTAATGAAGGGATTAGACCTGGACACAGCACAGTATATAGTTCACATGGAAGTTCAGATTATGACGCATCACAGTATAACGAAGACATGAAAAAATTCAGGAAGATGGCATTAGGAAGCCAGGAATATGGCAGCACTGGCCAATACAGTAATCCAACAAGTGAGTATGGTTTATATCCTTCTGGATCAAGCAGCGAAGGCCAACCGACTAGGGAAATGGAAATGGGTAGGACGAAAAAAGACAGTAGAGGTTTCAGTGGAAGTAAAGGATTTATTGGAAGCTCTTGA


Protein sequences

Name Description Sequence
Nta.9892 translated coding region predicted by ESTScan from UniGene Nta.9892

MSSPTPGASPAPTSPPAPPTNSTSPPPTAVASPPALPAQAPPPTSPTPPATTPPPTASASPPPPSTSAPSSSTPPPPTTQSTPEPSGSPPSPPSPPSGSSPSPPAPSGSGRSPAGPRGGGGSSTSSPASDEGSSGVSTGLVVGIAIGGVLILAVLSLLFICCSRRKKRRNHGPVEYYPPAQPPPMGYKADPYGDPVHHWQHNAPSPADHVVSIPPKPSPPPAGASRPPHSPVTASSLQPPPPPPYMSSSGASSNYSGFDPLPPPSPGMVLGFSKSTFTYEELVRATDGFSNANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGHSTVYSSHGSSDYDASQYNEDMKKFRKMALGSQEYGSTGQYSNPTSEYGLYPSGSSSEGQPTREMEMGRTKKDSRGFSGSKGFIGSS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
52-633 PTHR24420,FAMILY NOT NAMED

TPPPTASASPPPPSTSAPSSSTPPPPTTQSTPEPSGSPPSPPSPPSGSSPSPPAPSGSGRSPAGPRGGGGSSTSSPASDEGSSGVSTGLVVGIAIGGVLILAVLSLLFICCSRRKKRRNHGPVEYYPPAQPPPMGYKADPYGDPVHHWQHNAPSPADHVVSIPPKPSPPPAGASRPPHSPVTASSLQPPPPPPYMSSSGASSNYSGFDPLPPPSPGMVLGFSKSTFTYEELVRATDGFSNANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGHSTVYSSHGSSDYDASQYNEDMKKFRKMALGSQEYGSTGQYSNPTSEYGLYPSGS

HMMPanther: PTHR24420:SF822
52-633 PTHR24420:SF822

TPPPTASASPPPPSTSAPSSSTPPPPTTQSTPEPSGSPPSPPSPPSGSSPSPPAPSGSGRSPAGPRGGGGSSTSSPASDEGSSGVSTGLVVGIAIGGVLILAVLSLLFICCSRRKKRRNHGPVEYYPPAQPPPMGYKADPYGDPVHHWQHNAPSPADHVVSIPPKPSPPPAGASRPPHSPVTASSLQPPPPPPYMSSSGASSNYSGFDPLPPPSPGMVLGFSKSTFTYEELVRATDGFSNANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRALEGDVSLSDLNEGIRPGHSTVYSSHGSSDYDASQYNEDMKKFRKMALGSQEYGSTGQYSNPTSEYGLYPSGS

superfamily: SSF56112
IPR011009
259-562 Kinase_like
Protein kinase-like domain

DPLPPPSPGMVLGFSKSTFTYEELVRATDGFSNANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRAL

Gene3D: G3DSA:3.30.200.20
275-365 G3DSA:3.30.200.20

STFTYEELVRATDGFSNANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFV

ProfileScan: PS50011
IPR000719
289-568 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNANLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRALEGDVSL

HMMPfam: PF07714
IPR001245
293-562 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

NLLGQGGFGYVHRGVLPNGKEVAVKQLKAGSGQGEREFQAEVEIISRVHHKHLVSLVGYCITGSQRLLVYEFVPNNTLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRAL

PatternScan: PS00107
IPR017441
295-317 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGYVHRGVLPNGKEVAVK

Gene3D: G3DSA:1.10.510.10
369-562 G3DSA:1.10.510.10

TLEFHLHGKGRPPLDWPIRLKIALGSAKGLAYLHEDCQPKIIHRDIKAANILVDFNFEAKVADFGLAKLTSDVNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSYGIMLLELITGRRPVDSSQTYMDDSLVDWARPQLTRALEDEKFDSLIDPRLGNDYNHNEVARMVACAAACVRHSARRRPRMSQVVRAL

PatternScan: PS00108
IPR008271
409-421 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKAANILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox