PRGDB00071623 (Nta.10274)

From PRG Wiki
Jump to: navigation, search
Nta.10274
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32875602 (BP132717)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

BP132717 MAT001 Nicotiana tabacum cDNA clone BY4912, mRNA sequence

DNA Sequence

GCTCCGGCCGCATGGCGGCGCGGGAATCGATTGAGATATACTGCAGGTACTCCAATGGCGAAGACTTCATTAATGAAGTGGGCAGCATAGGCAGAATTCACCATGTGAATGTTGTGCGCTTAGTAGGATATTGTGCTGATGGTTACAGACGAGCTCTTGGTGTATGAATATTTACAAAACGACACGCTTCAAAAGATCATATCATCCGGGAATGAAAGAGGGTCATCACTAGGTTGGGAAAAGATGCAACAAATAGCAGTAGGAATCGCCAAAGGTATCGAGTATTTACACTCAAGGGTGCAATCAACAGAATTGTACATTTTGATATTAAGCCTCATAATATCTTGCTAGACCAAGATTTCAATCCGAAAGTTGCAGATTTTGGGCTGGCAAAGTTGTGTTCCAAGGAACAAAGTGCTGTATCAATGACTGCTGCTCGAGGCACCATTGGCTATATCGCTCCTGAAGTGTTCTCTAGGAACTATGGAAATGTGTCATATAAAGCAGATATTTATAGTTTTGGAATGCGGTTGCTTGATATGATTGGTGGAAGGAAGAAATTTGATGCTGCAAATGAGCAGAACAGTAGCAGTCAGATTTACTACCCCGAGTGGATGTACAAACAACTGGAGAAAGGAGAAGAAATAGAAATCCAAATTGACAATGAAGATGACAGCAGCACAATCCAGAACTAGCAATAGCAGGACTTTGGTGCATCAATG


Protein sequences

Name Description Sequence
Nta.10274 translated coding region predicted by ESTScan from UniGene Nta.10274

XSGRMAARESIEIYCRYSNGEDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPELAIAGLWCINX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-242 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XSGRMAARESIEIYCRYSNGEDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPELAIAGLWCINX

HMMSmart: SM00220
IPR002290
5-240 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MAARESIEIYCRYSNGEDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPELAIAGLWCI

HMMSmart: SM00219
IPR020635
11-216 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IEIYCRYSNGEDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEI

HMMPanther: PTHR24420:SF441
19-240 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NGEDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPELAIAGLWCI

HMMPanther: PTHR24420
19-240 FAMILY NOT NAMED,FAMILY NOT NAMED

NGEDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPELAIAGLWCI

Gene3D: G3DSA:3.30.200.20
19-50 no description

NGEDFINEVGSIGRIHHVNVVRLVGYCADGYR

superfamily: SSF56112
IPR011009
21-242 Protein kinase-like (PK-like)
Protein kinase-like domain

EDFINEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPELAIAGLWCINX

HMMPfam: PF00069
IPR017442
24-200 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

INEVGSIGRIHHVNVVRLVGYCADGYRRALGVXIFTKRHASKDHIIREXKRVITRLGKDATNSSRNRQRYRVFTLKGAINRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQI

Gene3D: G3DSA:1.10.510.10
103-231 no description

NRIVHFDIKPHNILLDQDFNPKVADFGLAKLCSKEQSAVSMTAARGTIGYIAPEVFSRNYGNVSYKADIYSFGMRLLDMIGGRKKFDAANEQNSSSQIYYPEWMYKQLEKGEEIEIQIDNEDXQQHNPE

PatternScan: PS00108
IPR008271
105-117 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDIKPHNILL

Seg: seg
214-227 seg

EEIEIQIDNEDXQQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox