PRGDB00071624 (Nta.10275)

From PRG Wiki
Jump to: navigation, search
Nta.10275
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 190145050 (FG641293)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

TT-28_F14 K326 trichome library Nicotiana tabacum cDNA, mRNA sequence

DNA Sequence

AATTGCAATGTTTGCTTTCACAGGGCAGTCAAATAGTAGTGTGTTTTGGTTTCAGGCTGTCACTGACTGATCCGGTCAAGATCGACAAGGGCAAAGCCCCTTCACTGGACATCGTGTCTAAAAATAGCAGAAGATGTGGCTCAGGGCCTTGCTTACATACATCAAGCATCAAAGCTCACTCATGGCAACTTGAAGACCTCAAATGTGCTTCTAGGGTCTGATTTCGAGGCCTGTCTAACAGACTACTCCCTCATTGCGCTTGCAGACATTTCTTCCGATGATGATCCTGATGCAGCACGCTATAAAGCACCAGAAGTTTGCAAATCTGCACGAAAAGCCACTCCAGGGTCTGACGTCTATGCCTATGGCATTCTGTTATTAGAGCTTTTAACGGGTAAACCGCCATCTCAGCATCCATTTCTCTCTCCCCCGGATATGGCGGATTGGGTTAGAGCTATGAGGGAGGATGATAACGAGGAGAATAGATGGCTCGCAATGCTAGTTGACCTTGCTAGTATATGTAGCTTGACATCACCAGAACAGAGACCAACAATGAGGCAAATCTTGAAAATGATACAAGATATAAAGGATAATGCAATGGTGGAGAATAACAAAAGGGATGAACATACTGGATATTCATAGCTTCTTCTGAATTGCAGTTATACCATTAACCAGCGAGGGTGCATGGTCAATTGTAAGTGTTACACCTGAAACNNNTTTGGATAATGCAATAATTAATCTGTGTCTCCTCCTTTGGCAAAGTGCCATTAATTGGCAACAGATTTGCTATTGACTTTTGCNNA


Protein sequences

Name Description Sequence
Nta.10275 translated coding region predicted by ESTScan from UniGene Nta.10275

XIAMFAFTGQSNSSVFWFQAVTXLIRSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMIQDIKDNAMVENNKRDEHTGYSXLLLNCSYTINQRGCMVNCKCYT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-202 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XIAMFAFTGQSNSSVFWFQAVTXLIRSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMIQDIKDNAMV

HMMSmart: SM00220
IPR002290
2-202 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

IAMFAFTGQSNSSVFWFQAVTXLIRSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMIQDIKDNAMV

HMMSmart: SM00219
IPR020635
3-193 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

AMFAFTGQSNSSVFWFQAVTXLIRSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMI

superfamily: SSF56112
IPR011009
24-193 Protein kinase-like (PK-like)
Protein kinase-like domain

LIRSRSTRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMI

Gene3D: G3DSA:1.10.510.10
28-207 no description

RSTRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMIQDIKDNAMVENNKR

HMMPfam: PF00069
IPR017442
30-191 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TRAKPLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILK

HMMPanther: PTHR24420
34-198 FAMILY NOT NAMED,FAMILY NOT NAMED

PLHWTSCLKIAEDVAQGLAYIHQASKLTHGNLKTSNVLLGSDFEACLTDYSLIALADISSDDDPDAARYKAPEVCKSARKATPGSDVYAYGILLLELLTGKPPSQHPFLSPPDMADWVRAMREDDNEENRWLAMLVDLASICSLTSPEQRPTMRQILKMIQDIKD

Seg: seg
84-100 seg

SLIALADISSDDDPDAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox