PRGDB00071626 (Nta.10583)

From PRG Wiki
Jump to: navigation, search
Nta.10583
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 190765255 (FG149067)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

AGN_RNC116xf11f1.ab1 AGN_RNC Nicotiana tabacum cDNA 5', mRNA sequence

DNA Sequence

TCGGTCCGGATTCCCGGGATTACCAAGTCAAATCCTGTAATTCCGCAGAGTACTAATCGTGATGCTAAAGACACTGAAAAGACAAGCAGCATTGTGGTAATACCCAAAAATCTCAAGGACCTGCGGCAAAATCCAGGGAGTAGTGATCTTGATATCTTCACATATGAAGAGATGAAGTTGTCTACTAAGCACTTTCGACCAGATAAGGTTCTTGGAGAGGGTGGATTCGGCATTGTGTACAAAGGAGTTATTGACGAACAGGTCAGGCCAGGGTACAAGACCACATACGTTGCCATTAAGGAGCTTGATCCGGAAGGTCTTCAGGGCGACAGAGAGTGGCTGGCAGAGGTGAACTACTTGGGGCAGCTTCGACATCCAAATTTGGTGAAGCTGATTGGATACTGCTGCGAGGATTACCATAGACTATTAGTTTATGAATATATGGCATCTGGCAGCCTGGAAAAGCACCTTTTTCCAAGAGTCTGTGCTACTCTAACGTGGTTAAGAAGAATGAGAATTGCTTTGGATGCTGCTAAAGGGCTTGCTTTTCTTCATGGAGCTGAAAGGCCTATAATATATAGGGACTTCAAGACGTCAAACATTTTGTTGGATGCGGAGTTTAATGCAAAGCTTTCTGACTTTGGACTTGCAAAAGATGGGCCTATGGGAGATCAAACACATGTATCAACTCGTGTAATGGGCACTTATGGCTATGCTGCTCCAGAGTATGTCATGACCGGACATCTAACAGCCAGAAGTGATGTTTATGGTTTTGGCGTTGTTTTGCTTGAAATGCTCATTGGAAGAGAGCAATGGACAAAAGTAAACCTAGCCGGAAAAACCTTGTAGAGTTTGCTCGACTCTCTTGATCATAGCAAGAGCTTTTCAGATATGACCC


Protein sequences

Name Description Sequence
Nta.10583 translated coding region predicted by ESTScan from UniGene Nta.10583

SVRIPGITKSNPVIPQSTNRDAKDTEKTSSIVVIPKNLKDLRQNPGSSDLDIFTYEEMKLSTKHFRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQWTKVNLAGKTLXSLLDSLDHSKSFSDMTX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF529
34-269 SUBFAMILY NOT NAMED

IPKNLKDLRQNPGSSDLDIFTYEEMKLSTKHFRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGR

HMMPanther: PTHR24420
34-269 FAMILY NOT NAMED,FAMILY NOT NAMED

IPKNLKDLRQNPGSSDLDIFTYEEMKLSTKHFRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGR

superfamily: SSF56112
IPR011009
37-276 Protein kinase-like (PK-like)
Protein kinase-like domain

NLKDLRQNPGSSDLDIFTYEEMKLSTKHFRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQWTKVN

Gene3D: G3DSA:3.30.200.20
48-134 no description

SDLDIFTYEEMKLSTKHFRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGY

ProfileScan: PS50011
IPR000719
65-300 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQWTKVNLAGKTLXSLLDSLDHSKSFSDMTX

HMMSmart: SM00220
IPR002290
65-296 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQWTKVNLAGKTLXSLLDSLDHSKSFS

HMMSmart: SM00219
IPR020635
65-295 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQWTKVNLAGKTLXSLLDSLDHSKSF

HMMPfam: PF07714
IPR001245
68-271 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

DKVLGEGGFGIVYKGVIDEQVRPGYKTTYVAIKELDPEGLQGDREWLAEVNYLGQLRHPNLVKLIGYCCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQ

PatternScan: PS00107
IPR017441
71-100 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGIVYKGVIDEQVRPGYKTTYVAIK

Gene3D: G3DSA:1.10.510.10
135-274 no description

CCEDYHRLLVYEYMASGSLEKHLFPRVCATLTWLRRMRIALDAAKGLAFLHGAERPIIYRDFKTSNILLDAEFNAKLSDFGLAKDGPMGDQTHVSTRVMGTYGYAAPEYVMTGHLTARSDVYGFGVVLLEMLIGREQWTK

PatternScan: PS00108
IPR008271
191-203 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDFKTSNILL

Seg: seg
282-297 seg

LXSLLDSLDHSKSFSD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox