PRGDB00071628 (Nta.10823)

From PRG Wiki
Jump to: navigation, search
Nta.10823
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83420547 (DW002541)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KR3B.103D14F.051108T7 KR3B Nicotiana tabacum cDNA clone KR3B.103D14, mRNA sequence

DNA Sequence

TCTGGAGGAAGTGTATATGACTATTTACACAAACAAAAGGGCAGTTTTAAACTTCCTACTTTGCTCAAAGTAGCAATTGATGTATCAAAAGGAATGAATTACCTGCATCAGAATAGTATCATACACAGGGACTTGAAGGCTGCCAATCTATTGATGGATGAAAATGAAGTTGTTAAAGTGGCTGATTTTGGTGTTGCCAGAGTGAAGGCACAGACTGGCGTCATGACGGCGGAGACCGGGACCTATAGATGGATGGCCCCTGAGGTTATAGAACACAAGCCATATGATCACAAAGCAGATATTTTCAGTTTCGGGGTTCTGTTATGGGAATTGATGACTGGAAAGCTCCCATATGAGTACTTGACCCCACTACAAGCTGCCATTGGAGTGGTCCAGAAGGGGTTGCGACCAATTATTCCCAAAAATACTCATCCAAAACTTGCTGAGTTGCTTGAAAAATGCTGGCAACGAGATCCAACGTCGAGGCCTGATTTCCCTGAAATAATAGAGATGTTGCAGCAAATAGCAAAAGAGGTTGCAGATGAGGAAGATGATCGTCGCAAGGAGAAGTCATCATCTGGAGGATTCTTTTCAGTCCTCAGACGTGGACACCACTAAGTAGATACACTTATAGAGAATGTTGATAAAAAATTATAATCTGATTACACGTTTCTAGCCTTATTTATCCATATTGTACAGATTTTTTCCTGATCAATGTTCTCGTCATTTTTAATATAAAGTTTTTGC


Protein sequences

Name Description Sequence
Nta.10823 translated coding region predicted by ESTScan from UniGene Nta.10823

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEMLQQIAKEVADEEDDRRKEKSSSGGFFSVLRRGHH

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-176 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEMLQQIA

HMMPanther: PTHR23257:SF82
1-188 PROTEIN KINASE ATMRK1,Ser-thr,PROTEIN KINASE ATMRK1

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEMLQQIAKEVADEEDDRRK

HMMPanther: PTHR23257
1-188 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEMLQQIAKEVADEEDDRRK

superfamily: SSF56112
IPR011009
1-172 Protein kinase-like (PK-like)
Protein kinase-like domain

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEML

HMMSmart: SM00219
IPR020635
1-172 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEML

HMMSmart: SM00220
IPR002290
1-176 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

SGGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEMLQQIA

Gene3D: G3DSA:1.10.510.10
2-192 no description

GGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEMLQQIAKEVADEEDDRRKEKSS

HMMPfam: PF07714
IPR001245
2-172 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

GGSVYDYLHKQKGSFKLPTLLKVAIDVSKGMNYLHQNSIIHRDLKAANLLMDENEVVKVADFGVARVKAQTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVLLWELMTGKLPYEYLTPLQAAIGVVQKGLRPIIPKNTHPKLAELLEKCWQRDPTSRPDFPEIIEML

FPrintScan: PR00109
IPR001245
34-52 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHQNSIIHRDLKAANLLM

PatternScan: PS00108
IPR008271
40-52 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKAANLLM

FPrintScan: PR00109
IPR001245
80-90 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
99-121 TYRKINASE
Serine-threonine/tyrosine-protein kinase

ADIFSFGVLLWELMTGKLPYEYL

FPrintScan: PR00109
IPR001245
143-165 TYRKINASE
Serine-threonine/tyrosine-protein kinase

THPKLAELLEKCWQRDPTSRPDF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox