PRGDB00071629 (Nta.10859)

From PRG Wiki
Jump to: navigation, search
Nta.10859
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 190731582 (FG197982)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

AGN_PNL226cr1_h1.trimmed.seq AGN_PNL Nicotiana tabacum cDNA 3', mRNA sequence

DNA Sequence

GAACCTGAAATACATTGAAATACTGTCAAAAGATCAGATAGTGGTACAGCTTCATTAGCTTCCTCTTTATCTCATCTGAGCTTCAATCAAAGACGCTAAAAGGACGTCCCAGTTTCACCTTCAAACCTTCAAAAGAATCTGTTCAATCTGCTCTTTATTTACAGAAGATTAAGTGATGTTGCATAACATAATTCATAGAAAAACTGCGGCCTTTATCGCTATGGCACTTCTTCCCTATGGTTAATAATCAGCAGCAATGTTCAACGTGGAAAAAGACTTCGTTTTTCGTTTTCAACCACCACTGGACTTGTTCAATTCTTCATTCACTAAAACCATACTTGGCCTACTGTCTGGATCCTCAAGGGTGCAACTTATTGCAAGTTTAGTAAGCAAAGTTGCTTCACTTACAGAGAATGTTCCCTTAAGATTTGGGTCAATGAAATTCTCAAAGTTGCAAGATTCAGCTGCAAGTCGCATTGAGCAGTCAAGAAGTCCTTTACCAGATAGTACTTGAAGGATAATTACTCCAAATGCATATACATCACTCTTTTCTGTGAACCGGCCAGTTGTAATGTATTCAGGAGCCATATATCCAAGCGCAGCACTGACCTTAAGCGCTGAATAAACGACATCATCAGCAAGTAGCTTTAGTAGACCACAGTCCAGTATTAGCGGAGTGAACTGTTGATCAAGTAGGACTTTTTCCACTGATATGTTGCGATGAACCATCGAAGGTTTGTTTGGTTCAGAGCTGT


Protein sequences

Name Description Sequence
Nta.10859 translated coding region predicted by ESTScan from UniGene Nta.10859

XSSEPNKPSMVHRNISVEKVLLDQQFTPLILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAISCTLEDPDSRPSMVLVNEELNKSSGG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-148 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XSSEPNKPSMVHRNISVEKVLLDQQFTPLILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAISCTLEDPDSRPSMVLVNEEL

Gene3D: G3DSA:1.10.510.10
7-144 no description

KPSMVHRNISVEKVLLDQQFTPLILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAISCTLEDPDSRPSMVLV

HMMPanther: PTHR24420
8-149 FAMILY NOT NAMED,FAMILY NOT NAMED

PSMVHRNISVEKVLLDQQFTPLILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAISCTLEDPDSRPSMVLVNEELN

superfamily: SSF56112
IPR011009
8-148 Protein kinase-like (PK-like)
Protein kinase-like domain

PSMVHRNISVEKVLLDQQFTPLILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAISCTLEDPDSRPSMVLVNEEL

HMMPfam: PF07714
IPR001245
9-147 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SMVHRNISVEKVLLDQQFTPLILDCGLLKLLADDVVYSALKVSAALGYMAPEYITTGRFTEKSDVYAFGVIILQVLSGKGLLDCSMRLAAESCNFENFIDPNLKGTFSVSEATLLTKLAISCTLEDPDSRPSMVLVNEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox