PRGDB00071631 (Nta.10985)

From PRG Wiki
Jump to: navigation, search
Nta.10985
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 190762858 (FG161848)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

AGN_RNC017xg19r1.ab1 AGN_RNC Nicotiana tabacum cDNA 3', mRNA sequence

DNA Sequence

AATAAGGAGAACTATAAGAAAGAAGTTTAGTCAAAATTTAGGAACATTACTTTTACAGAAAGAAATTGATTATATACACAGTCTTTATTGAAGAATTAATCATCGCTCTAGCATCTACCAAGAATGCAAAGAATCAACTGGCAGAAGGCCTACATTCTTGTAGCCGTGATAAGATTTCCTCACAACTAGGCCGTTCATCTGGTTCTGCCCAGCAATCTGAAATTAGTTTTCCTAGAGGACCTTCAGGAATTTCTAGCCGTTTTCCATCATTAGCAACAGCGTATACGACCTGGATAGATGGAACACCTTCCCATGGTTTTTTGAGTGTGTATAGTTCCCATATTATGACCCCAAAACTAAAAATGTCGCATTTTTCGGTGAAAGGTTCATTACGAATAAGCTCTGGGGCCATCCATTCTGGTGTACCTGCTGAGGAAGAATCTTGCATGGGCGTTGAAATCAGTAACCGCGATAGTCCAAAATCACAGATCTTGACTTTGTAGTGTTTATTTACAAGGCAGTTTCCACTCTTTAGATCACGATGCACGATTTTCATCCTATGTATACACAGCAGCCCCCTGCATATATCGCAAAGCATTTTCAATCTCCTTTGCCAGCTGAGGTTATTCTTCTGTCCACTTACATGGATCAGATGATACAGGGATCCCATCTCCATGAATTCGGTAATCACGGATAAACGAGGGGGGAGTTGTGCAAGCACCGAGACAGATTACATTTGGGTGGCGAATGCGGCTCAGATGGATATTTCATTGCAAATCTTCATGTTTCTTCACTCAGTCTGTCTAGAAACTACTGCA


Protein sequences

Name Description Sequence
Nta.10985 translated coding region predicted by ESTScan from UniGene Nta.10985

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRLQECRPSAS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-176 no description

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRLQECR

superfamily: SSF56112
IPR011009
1-172 Protein kinase-like (PK-like)
Protein kinase-like domain

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRL

HMMPanther: PTHR23257:SF158
1-175 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRLQEC

HMMPanther: PTHR23257
1-175 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRLQEC

ProfileScan: PS50011
IPR000719
1-179 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRLQECRPSA

HMMPfam: PF07714
IPR001245
1-172 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRL

HMMSmart: SM00220
IPR002290
1-179 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MEMGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRLQECRPSA

HMMSmart: SM00219
IPR020635
3-172 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

MGSLYHLIHVSGQKNNLSWQRRLKMLCDICRGLLCIHRMKIVHRDLKSGNCLVNKHYKVKICDFGLSRLLISTPMQDSSSAGTPEWMAPELIRNEPFTEKCDIFSFGVIIWELYTLKKPWEGVPSIQVVYAVANDGKRLEIPEGPLGKLISDCWAEPDERPSCEEILSRL

PatternScan: PS00108
IPR008271
43-55 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSGNCLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox