PRGDB00071632 (Nta.11030)

From PRG Wiki
Jump to: navigation, search
Nta.11030
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 190715413 (FG163406)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

AGN_RNC015xp24r1.ab1 AGN_RNC Nicotiana tabacum cDNA 3', mRNA sequence

DNA Sequence

ATCTGCCTTGTTATTAACAAGTGAATATACAAGGGCAGATAGACAATTTTCAGGACTGGGGAACACTGCCAAAAATACTAAAAAGATGAAACAAAAGAATCACCACTGGCTCAATATTATGTGTTTGTCAGGATCTTTTGATGCCTTCCTTTAGTTTCTTGTGCACAAATTTACAATTGTCTAACAAGAGATACTCCCCTTTCCTCCTTCACTAACTCTGATCTGCAGGTGGATCTTCTACGATTCGTGATGGCTGACCCTTTACCGGACCTCTGCCAGCCGGTGGTCTTGGTGCCTGTGAACTTATAGGCTTTTGTAGTGGTTTCAAAGCAGCCATAATCTCAGCAAATGAAGGCCGTAACCTCGGATCTGTTTGCCAGCATTTCCTGATAATGTCTGCAACAGCCGGATCCATGTCCTCTGGTATGTCAAGACGTCGGTGCTGAAATCCCACAGCACCAACAACTTGCATCGGGTTCATTCCTCCCCATGGTTGCTGCAAAGTACATAGCTCCCATAGTATGACGCCAAAGCTATATACATCACATTTTTCATTGGAAGGTTCATTTCTCAGCACTTCTGGGGCCATCCACTCTGCCGTCCCAGCAGTCGACCTGGATGAAAGAAATGTGCTGTGCTTCATTCTTGACAGTCCAAAATCACATACCTTCACAACCCAGTTCTTATCTACTAAGAGATTCGGAGACTTCAAATCTCGATGACTATCATGGGTGTGCAGTTGTGTAGATAGTTCATCCCTCGAGCAGCATCAGAGCATCCTAACTTCTGCGCTCATCTAACTGATTGTTGGGTCGATGGATATCTGTATAACTACTCTATGAGACTCAGTACATGGAA


Protein sequences

Name Description Sequence
Nta.11030 translated coding region predicted by ESTScan from UniGene Nta.11030

XPCTESHRVVIQISIDPTISXMSAEVRMLXCCSRDELSTQLHTHDSHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPLQKPISSQAPRPPAGRGPVKGQPSRIVEDPPADQSXXRRKGEYLLLDNCKFVHKKLKEGIKRS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-182 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPCTESHRVVIQISIDPTISXMSAEVRMLXCCSRDELSTQLHTHDSHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPLQ

HMMSmart: SM00220
IPR002290
3-181 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

CTESHRVVIQISIDPTISXMSAEVRMLXCCSRDELSTQLHTHDSHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPL

HMMSmart: SM00219
IPR020635
13-178 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

ISIDPTISXMSAEVRMLXCCSRDELSTQLHTHDSHRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAAL

FPrintScan: PR00109
IPR001245
39-57 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TQLHTHDSHRDLKSPNLLV

superfamily: SSF56112
IPR011009
47-238 Protein kinase-like (PK-like)
Protein kinase-like domain

HRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPLQKPISSQAPRPPAGRGPVKGQPSRIVEDPPADQSXXRRKGEYLLLDNCKFVHKKLKE

HMMPfam: PF07714
IPR001245
47-177 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

HRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAA

HMMPanther: PTHR23257:SF80
47-223 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

HRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPLQKPISSQAPRPPAGRGPVKGQPSRIVEDPPADQSXXRRKGEY

HMMPanther: PTHR23257
47-223 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

HRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPLQKPISSQAPRPPAGRGPVKGQPSRIVEDPPADQSXXRRKGEY

Gene3D: G3DSA:1.10.510.10
47-188 no description

HRDLKSPNLLVDKNWVVKVCDFGLSRMKHSTFLSSRSTAGTAEWMAPEVLRNEPSNEKCDVYSFGVILWELCTLQQPWGGMNPMQVVGAVGFQHRRLDIPEDMDPAVADIIRKCWQTDPRLRPSFAEIMAALKPLQKPISSQ

FPrintScan: PR00109
IPR001245
86-96 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTAEWMAPEVL

FPrintScan: PR00109
IPR001245
105-127 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDVYSFGVILWELCTLQQPWGGM

FPrintScan: PR00109
IPR001245
149-171 TYRKINASE
Serine-threonine/tyrosine-protein kinase

MDPAVADIIRKCWQTDPRLRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox