PRGDB00071635 (Nta.11521)

From PRG Wiki
Jump to: navigation, search
Nta.11521
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76869546 (DV160538)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

KP1B.103I06F.050725T7 KP1B Nicotiana tabacum cDNA clone KP1B.103I06, mRNA sequence

DNA Sequence

CAAAGAGAGAATGTTACTAGTAGGTGAATTGTACTCAGCTTATTCAATCTGCAGTTTTGCAGCTGGGATTGCAGGTAACCTCTTCGCGTTTGTCTTATTCGTGTCACCAATACCAACATTCAGAAGAATCATCAGAAGCAAGTCTACAGAACAGTTTTCTGGATTACCTTATATCTATGCACTCATTAATTGCTTAATATGCCTCTGGTATGGAACACCAATTGTATCTCCTGGTATTATATTGGTTTTCACTGTCAATTCAATTGGAGCAGTGCTCCAGCTAGTATATATCACCATCTTCATCATACATGCAGAGCGGTCAAAGAAGTTGAAAATGTTGGGGTTGTTGCTTGGCGTTTTTGCTGTATTTGCTGCTATTGTAGCCATCAGCATATATATGTTTGAGCCTCCCAGTCGGCAAACTTTTGTTGGATATTTATCAGTCATTTCTCTCATTTCCATGTTTGCTTCTCCACTATTCATTATTAATTTGGTGATCAAGACAAAGAGCGTGGAGTACATGCCGTTTTATCTATCGCTTGCAACTTTTCTCATGAGCCTCTCTTTCTTTGCCTATGGAATGTTCAAGAATGATCCATTCATCTCTGTACCAAATGGGATAGGAGCAATTCTTGGTGTCATACAACTGGTCCTATACTTCAGATATAGCAAATCAGAAGAGGAGCCAAGAGCACCTCTCTTGGATTCTTATGCATGAGACGCAAGACTACAGCTGGAGTCAAGATTCATTCATTAAGAAGTGATTTAAAACATTATCtcttttctttttctttttcttttctttttctttttctttttctttttcttttttcttttttcttttGCGGGAATTTG


Protein sequences

Name Description Sequence
Nta.11521 translated coding region predicted by ESTScan from UniGene Nta.11521

XKERMLLVGELYSAYSICSFAAGIAGNLFAFVLFVSPIPTFRRIIRSKSTEQFSGLPYIYALINCLICLWYGTPIVSPGIILVFTVNSIGAVLQLVYITIFIIHAERSKKLKMLGLLLGVFAVFAAIVAISIYMFEPPSRQTFVGYLSVISLISMFASPLFIINLVIKTKSVEYMPFYLSLATFLMSLSFFAYGMFKNDPFISVPNGIGAILGVIQLVLYFRYSKSEEEPRAPLLDSYA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
20-230 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

FAAGIAGNLFAFVLFVSPIPTFRRIIRSKSTEQFSGLPYIYALINCLICLWYGTPIVSPGIILVFTVNSIGAVLQLVYITIFIIHAERSKKLKMLGLLLGVFAVFAAIVAISIYMFEPPSRQTFVGYLSVISLISMFASPLFIINLVIKTKSVEYMPFYLSLATFLMSLSFFAYGMFKNDPFISVPNGIGAILGVIQLVLYFRYSKSEEEP

HMMPfam: PF03083
IPR004316
23-107 MtN3_slv
RAG1-activating protein-1-related

GIAGNLFAFVLFVSPIPTFRRIIRSKSTEQFSGLPYIYALINCLICLWYGTPIVSPGIILVFTVNSIGAVLQLVYITIFIIHAER

Seg: seg
109-130 seg

KKLKMLGLLLGVFAVFAAIVAI

HMMPfam: PF03083
IPR004316
143-227 MtN3_slv
RAG1-activating protein-1-related

FVGYLSVISLISMFASPLFIINLVIKTKSVEYMPFYLSLATFLMSLSFFAYGMFKNDPFISVPNGIGAILGVIQLVLYFRYSKSE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox