PRGDB00071636 (Nta.11525)

From PRG Wiki
Jump to: navigation, search
Nta.11525
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76869693 (DV160685)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KP1B.103O16F.050725T7 KP1B Nicotiana tabacum cDNA clone KP1B.103O16, mRNA sequence

DNA Sequence

GGATGAGGCGACGATTGTGGTGGTGAAACGGCTGAGGGAAGTAGGTGCTGCTAAAAAGGAGTTTGAACAACATATGGAGATTGTTGGAAGGGTTGGGAGGCACCCTAATATTGTCCCACTCCGTGCATATTATTATTCCAAGGATGAGAAACTTCTTGTTACTGAATACATGCCTGCTGGTAGCTTGTCAGCCGCCTTACATGGTAATAGAGGTATTGGAAGAACTCCACTAGACTGGGATACAAGATTGAAGATATCTCTAGGAGCAGCGAAAGGAATTGCCCACATCCACACTGAAGGTGGTGTCAAATTTACTCATGGGAACATTAAGTCCTCCAATGTACTTCTCACAAGAGACCAAGACGGATGCATTTCTGATTTTGGCTTAACACCTCTAATGAACTACATACCATTTAAGTATAGGTGTGCTGGTTACCGTGCTCCAGAAGTGATTGAAACGCGGAAAGGAACACAAAAATCCGATGTTTATAGCTTCGGAGTGTTGCTCCTTGAAATGCTGACAGCCAAATCCCCTATCCCATTATCAGGACATGATGAGGTAGTTGACTTGCCCAGGTGGGTACGGTCCGTTGTTAGAGAGGAATGGACTGCTGAAGTTTTCGACGTAGAGCTGTTGAAGTACCAGAATATTGAAGAAGAGATGGTGCAGATGCTTCAGATAGGACTTGCTTGTGTA


Protein sequences

Name Description Sequence
Nta.11525 translated coding region predicted by ESTScan from UniGene Nta.11525

XDEATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-233 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XDEATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACV

HMMSmart: SM00220
IPR002290
1-226 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XDEATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQML

HMMPanther: PTHR24420:SF779
2-233 SUBFAMILY NOT NAMED

DEATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACV

HMMPanther: PTHR24420
2-233 FAMILY NOT NAMED,FAMILY NOT NAMED

DEATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACV

HMMPfam: PF00069
IPR017442
3-183 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLS

Gene3D: G3DSA:3.30.200.20
4-45 no description

ATIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYY

superfamily: SSF56112
IPR011009
5-233 Protein kinase-like (PK-like)
Protein kinase-like domain

TIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQMLQIGLACV

HMMSmart: SM00219
IPR020635
5-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

TIVVVKRLREVGAAKKEFEQHMEIVGRVGRHPNIVPLRAYYYSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVELLKYQNIEEEMVQML

Gene3D: G3DSA:1.10.510.10
46-189 no description

YSKDEKLLVTEYMPAGSLSAALHGNRGIGRTPLDWDTRLKISLGAAKGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEVIETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox