PRGDB00071637 (Nta.11532)

From PRG Wiki
Jump to: navigation, search
Nta.11532
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76869759 (DV160751)
Gene Class T
Domain Type TIR, LRR
Gene Species Nicotiana tabacum

Comment?

KP1B.104B18F.050725T7 KP1B Nicotiana tabacum cDNA clone KP1B.104B18, mRNA sequence

DNA Sequence

ACAGTAATCATTAATTTTCCGGCAATTACTTCACCATCAATCAACAAAAATGGCACCTGAACTCAGTTACGATGCGTATTTGAGTTTTAGCGAGACAGGAAATATAGGCCAAACCTTCGTCAGCCATTTGCATGGAGCTTTGAAACAAGAAGGGATTTACACCTTCAAAGATGATCGGAACCAAGACAGAGGAACATCGGTTTCAAAGGATTCGTCCAGAGCTATTGCAGAATCCCAGATTATAGTTGTTGTCTTCTGCGAGAATTTTGTTTTATCTAAAGATTGTTTGGATGAAGTTGTAAAGATTATGGATTGCAGAAAACTGTTAAAGAAGATTGTGATACCGATATTCTACGACGTGGAACCATCGGAAGTACGAAGGCAAAGGAACAGCTTGGCCGAGGCATTTGCTGATGATAGTGAAAATGATGATGAGATTGGAAGATCAGAAAGGGTGAAAAGATGGAGGGATGCTTTGAATGAAGCAGGAAATATATCAGGCTTGGATCTCCGCAAGACACATGACGGGAATGAAGCGGAATGTATAGAGCAGATAGTGAAGGAGATTGTTAGCAAGCTAAGATCGGAAGAAGTGGCCGGAGAACGTCAAAAGGATGTGGAATTCGGAAGTAAATTCCTGTCGGAGAGAGTCCTTGGCTTCACTCGTTCAGCAGCATCTCCTTTCCCATTATGTGTGCCTGTAtttttttttGTGACCATTTATAGTATTTAAAAAAGTGAGCAAACTTTCTGGTTCAAATAAAAATATAAAAGACGACGATCG


Protein sequences

Name Description Sequence
Nta.11532 translated coding region predicted by ESTScan from UniGene Nta.11532

MAPELSYDAYLSFSETGNIGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALNEAGNISGLDLRKTHDGNEAECIEQIVKEIVSKLRSEEVAGERQKDVEFGSKFLSERVLGFTRSAASPFPLCVPVFFFVTIYSI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-152 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

MAPELSYDAYLSFSETGNIGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALNEAGNISGL

Gene3D: G3DSA:3.40.50.10140
5-131 no description

LSYDAYLSFSETGNIGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIG

ProfileScan: PS50104
IPR000157
5-149 TIR
Toll-Interleukin receptor

LSYDAYLSFSETGNIGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALNEAGNI

HMMSmart: SM00255
IPR000157
6-149 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDAYLSFSETGNIGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALNEAGNI

HMMPfam: PF01582
IPR000157
9-144 TIR
Toll-Interleukin receptor

AYLSFSETGNIGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALN

HMMPanther: PTHR23155:SF344
19-184 SUBFAMILY NOT NAMED

IGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALNEAGNISGLDLRKTHDGNEAECIEQIVKEIVSKLRSEEVAG

HMMPanther: PTHR23155
19-184 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGQTFVSHLHGALKQEGIYTFKDDRNQDRGTSVSKDSSRAIAESQIIVVVFCENFVLSKDCLDEVVKIMDCRKLLKKIVIPIFYDVEPSEVRRQRNSLAEAFADDSENDDEIGRSERVKRWRDALNEAGNISGLDLRKTHDGNEAECIEQIVKEIVSKLRSEEVAG

Seg: seg
211-222 seg

PFPLCVPVFFFV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox