PRGDB00071638 (Nta.11537)

From PRG Wiki
Jump to: navigation, search
Nta.11537
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76869853 (DV160845)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KP1B.104F22F.050725T7 KP1B Nicotiana tabacum cDNA clone KP1B.104F22, mRNA sequence

DNA Sequence

GACTATGTTTCAAATGGAAGCTTAGCTAATGTTGGTTACAGAAAAGTTGGTTCTTCTCCTTACTTTTTACCATATGAAGTCCGGCTCAAGATAGCAAAAGGAATCGCAAGAGGATTGACCTACATCCACGAGAAGAAACACGTGCATGGCAATATCAAACCTAGTAACATTCTCTTAACTCAAGATATGGAGCCTATAATCAGTGACCTCGGGCTTCATGGGCTAATGCATGGTAAAAATAGCTGCAAACCGGATAATTCGGCCCGGCATTTTGGTAGCAAGCGGTCCACATCCTCCCGAGACGGTTTAAATGATCAACCGATTCATGGTAGCCCTTATATTGCCCCGGCCGGGTTCGTTGGGTGCACGTCCCCGTACCACGCACCCGAGTCGCTGCAGAGCCTCAAGCCTAGTCCTAAATGGGATGTTTATTCCTTTGGTATTGTGTTGCTTGAGCTTCTAACCGGGAAAGTATTTTCGGACCGGGAGTTGAGCCAGTGGACCACCGGTCCAGTAGTGGATGACAAGAACCGGGTGTTGAAAATGGCTGATGTGGCAATTAGAGCTGACGTGGTGAGAAAGGAAGAGACCACGGTGTCATTATTTAAGCTAGGGTTTAGTTGTGCATCATTGAATCCACAAAAAAGGCCTACAATGAAAGATGCCCTTCATATGCTGGATAAAGTACCAGGTTATTCACATTACTAATCATTATGTTGGACCAAGAAAAGCTACTAAAGTATTATTTGGGGTGTAAAGGGCTGTAGTTCTCTTTGTTCTTCTTTTGACTGTTGGAAAGATTTTGCTACATAAAGAGGGGAGAGAACCGTTGTTGTAATTGATGAAAGTGTTGTAAGTTTGACTAATTGATCAAGAATTTATTTATTTTGGATTAACC


Protein sequences

Name Description Sequence
Nta.11537 translated coding region predicted by ESTScan from UniGene Nta.11537

DYVSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHMLDKVPGYSHY

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-226 Protein kinase-like (PK-like)
Protein kinase-like domain

DYVSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHML

HMMPanther: PTHR24420:SF470
1-229 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DYVSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHMLDKV

HMMPanther: PTHR24420
1-229 FAMILY NOT NAMED,FAMILY NOT NAMED

DYVSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHMLDKV

ProfileScan: PS50011
IPR000719
1-235 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DYVSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHMLDKVPGYSHY

HMMSmart: SM00220
IPR002290
1-226 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

DYVSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHML

HMMSmart: SM00219
IPR020635
3-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VSNGSLANVGYRKVGSSPYFLPYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHML

HMMPfam: PF00069
IPR017442
24-224 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

PYEVRLKIAKGIARGLTYIHEKKHVHGNIKPSNILLTQDMEPIISDLGLHGLMHGKNSCKPDNSARHFGSKRSTSSRDGLNDQPIHGSPYIAPAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALH

Gene3D: G3DSA:1.10.510.10
115-227 no description

APAGFVGCTSPYHAPESLQSLKPSPKWDVYSFGIVLLELLTGKVFSDRELSQWTTGPVVDDKNRVLKMADVAIRADVVRKEETTVSLFKLGFSCASLNPQKRPTMKDALHMLD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox