PRGDB00071640 (Nta.11750)

From PRG Wiki
Jump to: navigation, search
Nta.11750
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 83420375 (DW002369)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

KR3B.102L11F.051107T7 KR3B Nicotiana tabacum cDNA clone KR3B.102L11, mRNA sequence

DNA Sequence

GGCCATTACGGCCGGGGAGAAAAATGGGAAGTCAAAGATGATGAGTTCCCTGCACTCAAAGCGTTGAAACTGGACGATGTAGTTATCTCTCAATGGGATGTCTCTGATGATGCGTTTCCTAGTCTTGAGAAATTGGTTTTGCAAAGATGTAAGAAGCTTAAGGAGATCCCTTCTTGTTTCGGTTACAACTGTTCTATACAAAGCATTGAAGTTAGTTGGTGCAGCCTTTCCGTCACTGAATCGCTAAGCAAATTCAGGATACACAAGTTGATGACATGGGAAATGGTGGATTCAAAATCTTTATCTAGCAAATTCAGGAGTCCCTTGGCCAAGATTCTGCACTATTCGTGACAGGTGAGGGCGCGATGCTGTGATTAAGAGGGAAATTCGTGGAAGTTCACACTGCTAGTTATTGTGGACTTTTATCATACAAACTTGAATTGTTTGCTGTGTTTGCTTGTGTAATATGTTTCAAGCCTAAGAATAAATCTTGTGAGACCTTTGTATTTGTCTATGTTTGTTGCTGCAACAATGTTTCAAACATAACACTAAATCATGTGAGACCTTTGTATTTGCTTGTGTAATACTATTGAAATCCTTTTCTCTTCCG


Protein sequences

Name Description Sequence
Nta.11750 translated coding region predicted by ESTScan from UniGene Nta.11750

GHYGRGEKWEVKDDEFPALKALKLDDVVISQWDVSDDAFPSLEKLVLQRCKKLKEIPSCFGYNCSIQSIEVSWCSLSVTESLSKFRIHKLMTWEMVDSKSLSSKFRSPLAKILHYS

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
16-85 no description

FPALKALKLDDVVISQWDVSDDAFPSLEKLVLQRCKKLKEIPSCFGYNCSIQSIEVSWCSLSVTESLSKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox