PRGDB00071668 (Nta.13329)

From PRG Wiki
Jump to: navigation, search
Nta.13329
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 156665317 (AM809632)
Gene Class Unknown
Domain Type LRR
Gene Species Nicotiana tabacum

Comment?

AM809632 seedling library, SL Nicotiana tabacum cDNA clone nt002161062, mRNA sequence

DNA Sequence

GAAGTCATTTCATTTGGAGAGGACAGGTACCCCTCATGCGGCCGCTCGGCCATTCACTAGTTTCTTGCAATCGACAATCTGAAGGACTTCTAAATTGAAGGGCAATCCTCCTTCAGGAAAGGACTCCGTTTCTGGACAATTTTCCAGTACCAGTTTCTTAAGAGATGGAAGGAGTTCATGCATTCCTTCTGGTGGCAACTTTAGCTTCTGGCTTTTGCTAATATGCAAATCAAGCAACGACGTGGTCTGAGTCCCACATGCCACTGAAAGTATTTCAAGATTCTCACATATGTTAATTTCTAGTATCTCGATCCCAGTGGGAATCAAAAGCCTTGTGAGGCGGTAACAACGCTCAATTCTCAAAATGCGTGTACTTGGTACGAACTCAGGTGGTATATCATCTATAGAATAACATCCATCTAGTGTCAATCTCTCGAGAAACATGTTACTTATGCAGCGGCCGCATGAGGGGATCCTCTAGAGTCGACGGCATGccctgctttaatgagatatgcgagacgcctatgatcgcatgatatttgctttcaattctgttgtgcacgttgtaaaaaacctgagcatgtgtagctc


Protein sequences

Name Description Sequence
Nta.13329 translated coding region predicted by ESTScan from UniGene Nta.13329

XATHAQVFYNVHNRIESKYHAIIGVSHISLKQGMPSTLEDPLMRPLHKNMFLERLTLDGCYSIDDIPPEFVPSTRILRIERCYRLTRLLIPTGIEILEINICENLEILSVACGTQTTSLLDLHISKSQKLKLPPEGMHELLPSLKKLVLENCPETESFPEGGLPFNLEVLQIVDCKKLVNGRAAA

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
46-176 no description

LHKNMFLERLTLDGCYSIDDIPPEFVPSTRILRIERCYRLTRLLIPTGIEILEINICENLEILSVACGTQTTSLLDLHISKSQKLKLPPEGMHELLPSLKKLVLENCPETESFPEGGLPFNLEVLQIVDCK

superfamily: SSF52058
52-180 L domain-like,LRR

LERLTLDGCYSIDDIPPEFVPSTRILRIERCYRLTRLLIPTGIEILEINICENLEILSVACGTQTTSLLDLHISKSQKLKLPPEGMHELLPSLKKLVLENCPETESFPEGGLPFNLEVLQIVDCKKLVN

Seg: seg
94-108 seg

IEILEINICENLEIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox