PRGDB00071672 (Nta.13605)

From PRG Wiki
Jump to: navigation, search
Nta.13605
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 309375273 (HO844050)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

NT2C-EST-1096 Tobacco two-celled proembryo cDNA library Nicotiana tabacum cDNA 5', mRNA sequence

DNA Sequence

GATAGGTCGAGGACTGGAGTATTTGCACCGAGGATGCATTGCACGAATATTGCATTTTGACATAAAACCTCACAATATCCTTCTGGATGAGGACTTCTGCCCCAAGATATCTGTTTTTGGCCTAGCAAAATTATGCCTTCAGAAAGAAAGCATCATATCAATGTTGGAAGCTAGAGGAACCATCGGTTACATTGCTCCAGAAGTATTCAGTAGAAATTTCGGAAGTGTCTCACACAAATCTGATGTTTACAGCTACGGAATGATGGTTCTTGAAATGGTTGGAGGAAGAAGGAATTACAGCGCTGAAAGAAGCAATCATAGCGAAATATACTTCCCACGTTGGGCTTATCAACGCCTTGTGACAGATGAAGACATAAATATACAATGCAGCACGACAAAGGAAGAAAAGGAAATTGCAAAGAAGATGATATTAGTAGGTTTGTGGTGCATTCAAACTGATCCGTCGTAGAGACCACCAATGAGTAAGGCAATTGAAATGCTGGAAGGTAGCTTAGAGGCCACCCAATTTCCACCGAAGCCTTTCATATGTTCTCCCTCAAGATCAGAAGGATCGACGATAATATCTTTGGGGCAGCCAACGAAGCCCTTTATATATTCTTCTACGAGTTCAGCACTTGATTCTACAGCCTCAGCAAGTG


Protein sequences

Name Description Sequence
Nta.13605 translated coding region predicted by ESTScan from UniGene Nta.13605

XIGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEMLEGSLEATQFPPKPFICSPSRSEGSTIISLGQPTKPFIYSSTSSALDSTASASX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-183 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XIGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEMLEGSLEATQFPPKPFI

HMMSmart: SM00220
IPR002290
1-168 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XIGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEML

superfamily: SSF56112
IPR011009
2-191 Protein kinase-like (PK-like)
Protein kinase-like domain

IGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEMLEGSLEATQFPPKPFICSPSRSEG

HMMPanther: PTHR24420:SF441
2-190 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEMLEGSLEATQFPPKPFICSPSRSE

HMMPanther: PTHR24420
2-190 FAMILY NOT NAMED,FAMILY NOT NAMED

IGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEMLEGSLEATQFPPKPFICSPSRSE

HMMPfam: PF00069
IPR017442
2-165 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

IGRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAI

Gene3D: G3DSA:1.10.510.10
3-176 no description

GRGLEYLHRGCIARILHFDIKPHNILLDEDFCPKISVFGLAKLCLQKESIISMLEARGTIGYIAPEVFSRNFGSVSHKSDVYSYGMMVLEMVGGRRNYSAERSNHSEIYFPRWAYQRLVTDEDINIQCSTTKEEKEIAKKMILVGLWCIQTDPSXRPPMSKAIEMLEGSLEATQ

PatternScan: PS00108
IPR008271
17-29 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHFDIKPHNILL

Seg: seg
207-221 seg

SSTSSALDSTASASX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox