PRGDB00071707 (Nta.16129)

From PRG Wiki
Jump to: navigation, search
Nta.16129
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 76870738 (DV161730)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Nicotiana tabacum

Comment?

KP1B.109A05F.050727T7 KP1B Nicotiana tabacum cDNA clone KP1B.109A05, mRNA sequence

DNA Sequence

GATAGAGAAGTAGAAGAAGAGGGAGAAATGGGTTGGTTTCCATGTTCTGGATCATCGAAGCAGACCTCAAAGAAGAGGAAAAAGAAGAAAGACTCGACCAATTCGGTCCAACTTGGTTCTGAAAAGTTGAAGGCAAAGAATCTGTTAGGCTCAAAGGACGATGTTAAGGATGGAGAGTCTAGTCAAATTGCAGCCAAGACTTTCACATTTCGTGAATTAGCAGCTGCAGCAAGAAACTTTCGAGGTGATTGTCTTCTTGGAGAGGGAGGTTTTGGAAGAGTATACAAAGGGCGGCTCGATTCCAATCAGATTGTTGCCATCAAGCAACTCGATCGTAATGGATTGCAAGGGAACAGGGAATTTCTTGTTGAAGTGCTAATGCTAAGTTTGTTACACCATCCTAACCTGGTAAATTTAATTGGCTATTGTGCTGACGGAGATCAGAGACTTCTGGTTTACGAATATATGCCACTAGGATCATTGGATGACCATCTTCATGATCTTACGCCCGCTAAGAAAGTGCTCGATTGGAACACGAGAATGAAAATTGCAGCTGGAGCAGCAAAGGGCTTGGAATATTTACATGACAAGGCAAGCCCGCCCGTAATATACCGCGATTTAAAATGCTCTAATATTTTGCTTGGTGAGGGGTATCATCCAAAGCTATCCGACTTCGGATTGGCCAAGTTGGGGCCCGTTGGAGATAACACCCATGTCTCGACAAGAGTTATGGGTACTTATGGGTACTGCGCTCCGGAGTATGCTATGACTGGTCAGTTGACTTTAAAGTCGGATGTTTACAGCTTTGGGGTTGTCCTCTTGGAGATCATAACTGGCAGGAAAGCAATTGAAAATTCAAAAACTGGAGGAGAGCACAATCTGGTTGCATGGGCAAGACCCTTGTTCAAAGA


Protein sequences

Name Description Sequence
Nta.16129 translated coding region predicted by ESTScan from UniGene Nta.16129

DREVEEEGEMGWFPCSGSSKQTSKKRKKKKDSTNSVQLGSEKLKAKNLLGSKDDVKDGESSQIAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKX

Domains

Domain Start-End Description Sequence

Seg: seg
16-35 seg

SGSSKQTSKKRKKKKDSTNS

superfamily: SSF56112
IPR011009
52-301 Protein kinase-like (PK-like)
Protein kinase-like domain

KDDVKDGESSQIAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPL

HMMPanther: PTHR24420:SF799
63-303 SUBFAMILY NOT NAMED

IAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFK

HMMPanther: PTHR24420
63-303 FAMILY NOT NAMED,FAMILY NOT NAMED

IAAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFK

Gene3D: G3DSA:3.30.200.20
64-141 no description

AAKTFTFRELAAAARNFRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIG

ProfileScan: PS50011
IPR000719
80-304 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLFKX

HMMSmart: SM00220
IPR002290
80-302 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLF

HMMSmart: SM00219
IPR020635
80-302 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRGDCLLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTGGEHNLVAWARPLF

HMMPfam: PF00069
IPR017442
85-289 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LLGEGGFGRVYKGRLDSNQIVAIKQLDRNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENSKTG

PatternScan: PS00107
IPR017441
86-108 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGRVYKGRLDSNQIVAIK

Gene3D: G3DSA:1.10.510.10
142-286 no description

YCADGDQRLLVYEYMPLGSLDDHLHDLTPAKKVLDWNTRMKIAAGAAKGLEYLHDKASPPVIYRDLKCSNILLGEGYHPKLSDFGLAKLGPVGDNTHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIENS

PatternScan: PS00108
IPR008271
202-214 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDLKCSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox