PRGDB00071793 (Nta.21862)

From PRG Wiki
Jump to: navigation, search
Nta.21862
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 32890431 (BP136841)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

BP136841 MAT001 Nicotiana tabacum cDNA clone BY9467, mRNA sequence

DNA Sequence

AGGATAAACTAAATACGGTAGCTCATATCAACGTCAGAAATACTAAAGTTTTAACATTGTACAGAAGGTCCATCAAATACATTGGCATCATAGATATAACAGTTTGACTACTGATAGCTATAGATGTTTGCTGGTTTGTACAAAAATAAATGTAAATGGCTGCCTGGAAATATACCCGGAATGGATATAATCACACCTCCTGCACCATCTTCTCCCAGATTTCTCTTACGTCGATTTCTATATTAAAGATAGAAATGCAAATCTGTAGCAGATTATTCTCTCCATCGGCTGTCTTCTCACTGTGTGAGCAGCTTTGAGTCACATGCCACAATCTTAACGCAGCTAACAGTCTCTTGGCATTCTTCGCTCTTGAACACAGCATCTTGTAAGATAAATGTCCACACATTGTCACAGAATCTGTAGGTATGAAGATGTCCCTTAATAGTAACCTTGGTCTTTACTTGACTCTCCAAAGCTTCAGTCATTGACTTGTCAAACTGAACAAGAACTTGAA


Protein sequences

Name Description Sequence
Nta.21862 translated coding region predicted by ESTScan from UniGene Nta.21862

XQVLVQFDKSMTEALESQVKTKVTIKGHLHTYRFCDNVWTFILQDAVFKSEECQETVSCVKIVACDSKLLTQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10966
IPR003194
2-69 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

QVLVQFDKSMTEALESQVKTKVTIKGHLHTYRFCDNVWTFILQDAVFKSEECQETVSCVKIVACDSKL

superfamily: SSF50784
IPR009088
18-68 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKTKVTIKGHLHTYRFCDNVWTFILQDAVFKSEECQETVSCVKIVACDSK

HMMPfam: PF02751
IPR015871
18-67 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKTKVTIKGHLHTYRFCDNVWTFILQDAVFKSEECQETVSCVKIVACDS

Gene3D: G3DSA:2.30.18.10
IPR009088
21-71 no description
Transcription factor IIA, beta-barrel

TKVTIKGHLHTYRFCDNVWTFILQDAVFKSEECQETVSCVKIVACDSKLLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox