PRGDB00071868 (Nta.27659)

From PRG Wiki
Jump to: navigation, search
Nta.27659
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 309373163 (HO841166)
Gene Class Unknown
Domain Type
Gene Species Nicotiana tabacum

Comment?

NTZC-EST-0568 Tobacco zygote cell cDNA library Nicotiana tabacum cDNA 5', mRNA sequence

DNA Sequence

GACATACTCAACTTTAGAAAGAAGATAGAATATGGATATGATCAAAGTTGGCCCAGTGGGAGGTTATGATATTGGTGGAACCATTTGGGATGAAAAGGGACGAGATCAAGTTGGTGGGATTCTTGTTTCCTATAGCAAAGACGGAGTCGATTCACTTCAGTTCTTGTTCTATGAGAATGGAAACTTAGTTCAGTCAAACAAACATGGTATTCATCACCGCGAGAACTTCTGCGCAGTTTTCTTTGATTATCCATTAGAGTTTCTTACTTCGATAAGTGGTTCCTCCGAAAAAGTGAGTCAGTACATGAGCTCCACAATTTTGACATCTATAGTATTTGGCACGAACAAGGGTTCTTATGGACCATTTGGGAAATTCTCAAATGATGTTGACAATGATATTGACTTCAACTTTCACATAGGAAATCATCGTCTGTTTGGTGGTTTTCATGGTAGCCAGAATTGCCATGGCATTGAGAGTATAGGGGTCTATGTGAAGACTACCACATCCTCCATGACCCATTGAAAAATCCTCGAGTAAAGGGTGAAAAGGAAGAAAAAGATTTACTCTAAGGTATTTTTACCTTCTAAAAATTTCCAAAAGATATATTCCGTTTTATTTTGCTACTATATGCATTATGCTTTTCTATCTTAAAAAGACAACGAAATTTGAACAAGTTTTTTT


Protein sequences

Name Description Sequence
Nta.27659 translated coding region predicted by ESTScan from UniGene Nta.27659

MDMIKVGPVGGYDIGGTIWDEKGRDQVGGILVSYSKDGVDSLQFLFYENGNLVQSNKHGIHHRENFCAVFFDYPLEFLTSISGSSEKVSQYMSSTILTSIVFGTNKGSYGPFGKFSNDVDNDIDFNFHIGNHRLFGGFHGSQNCHGIESIGVYVKTTTSSMTH

Domains

Domain Start-End Description Sequence

superfamily: SSF51101
IPR001229
3-155 Mannose-binding lectins
Mannose-binding lectin

MIKVGPVGGYDIGGTIWDEKGRDQVGGILVSYSKDGVDSLQFLFYENGNLVQSNKHGIHHRENFCAVFFDYPLEFLTSISGSSEKVSQYMSSTILTSIVFGTNKGSYGPFGKFSNDVDNDIDFNFHIGNHRLFGGFHGSQNCHGIESIGVYVK

Gene3D: G3DSA:2.100.10.30
IPR001229
3-155 no description
Mannose-binding lectin

MIKVGPVGGYDIGGTIWDEKGRDQVGGILVSYSKDGVDSLQFLFYENGNLVQSNKHGIHHRENFCAVFFDYPLEFLTSISGSSEKVSQYMSSTILTSIVFGTNKGSYGPFGKFSNDVDNDIDFNFHIGNHRLFGGFHGSQNCHGIESIGVYVK

HMMPfam: PF01419
IPR001229
16-155 Jacalin
Mannose-binding lectin

GTIWDEKGRDQVGGILVSYSKDGVDSLQFLFYENGNLVQSNKHGIHHRENFCAVFFDYPLEFLTSISGSSEKVSQYMSSTILTSIVFGTNKGSYGPFGKFSNDVDNDIDFNFHIGNHRLFGGFHGSQNCHGIESIGVYVK

HMMSmart: SM00915
IPR001229
16-156 Jacalin-like lectin domain
Mannose-binding lectin

GTIWDEKGRDQVGGILVSYSKDGVDSLQFLFYENGNLVQSNKHGIHHRENFCAVFFDYPLEFLTSISGSSEKVSQYMSSTILTSIVFGTNKGSYGPFGKFSNDVDNDIDFNFHIGNHRLFGGFHGSQNCHGIESIGVYVKT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox