PRGDB00072021 (Os.12011)

From PRG Wiki
Jump to: navigation, search
Os.12011
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 66916620 (CX103468)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Japonica Group

Comment?

RECm4476 A normalized whole-life-cycle cDNA library of rice Oryza sativa (indica cultivar-group) cDNA clone POLLNA12, EI096K17, EI104J03 5', mRNA sequence

DNA Sequence

GGCTGCGCTGGTCGGTCGGAATCCGGGTGACCACGCGTCGCGCTCCTCTCTCTTTGCGCCAACAAGCGACTCGCGATCTCATCGGGGCAAGAAGAGCAGAGCAGAGCAGTGGAGGGGATCCTGCAGATCTGGAAGAAGCTCTTAATTTCAGAGCCTTAACCTCTCTTAATACTACAAGTAACAACAGTTTTGTTGTTTGTTCCCCCCACCCCAAAAAGTTTAGGCGCACGCATCGCCCATGGCCACCTTCGAGCTCTACCGGAGGTCCACCATTGGCATGTGCCTCACTGAGACGCTCGACGAGATGGTCTCCAGCGGCACCCTCAGCCCGGAGCTCGCCATTCAAGTTCTTGTCCAGTTTGATAAGTCTATGACGGAAGCCTTGGAGAACCAAGTCAAGAGCAAGGTTTCTATCAAGGGCCACCTGCACACTTACAGGTTCTGTGACAATGTATGGACATTCATCTTGACTGAAGCATCATTCAAGAACGAGGAGACTACAGAACAAGTTGGCAAGGTGAAGATTGTGGCCTGTGATTCCAAACTACTCAGCCAATAAATTGATAACTGCGAGATCAGGGTTTGCCTGGTATATGTTAGTCTCTTCTGCTAGAACTGGCTCCGGCCTGAAAGTGTACTGTACCAACAAATTGTATGATACATAATCAATGTTGTGTAAATACAATCGTATGTGCTTACCAGAGTATATAAAAGCAGCACTGGTTTAATATGTATGCTAATGTTAATTGTTATGCAATGGTGTGTTGTAAGTGTATAATGATAACGAGAGTGTAAATGGAGAGTACTACCTACTATTTACCGTGGTAGTGAATGGATTAGAACGACACATCGCATAAGGACAGTAGTCATATAACAGAAAATAAGCAAACGGGTAGGAGTGGTAATCTGTTATGGTGTTCATTCTTATGGGngaagagagagaaaaaatacagcaaagatacaaagacgaagaaaagagaatacgatagtaaaggaagagaataaagaagaaagatgaaagaaatatataataatacgataagaagagagagagagaacgatagaagagaaagaatggagagagaaaggagaagaaaaacaataagagagagcaaagaaaAGAGGA


Protein sequences

Name Description Sequence
Os.12011 translated coding region predicted by ESTScan from UniGene Os.12011

XLRWSVGIRVTTRRAPLSLRQQATRDLIGARRAEQSSGGDPADLEEALNFRALTSLNTTSNNSFVVCSPHPKKFRRTHRPWPPSSSTGGPPLAMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSKLLSQ

Domains

Domain Start-End Description Sequence

Seg: seg
80-91 seg

PWPPSSSTGGPP

Gene3D: G3DSA:1.10.287.190
IPR015872
92-134 no description
Transcription initiation factor IIA, gamma subunit

LAMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALENQVK

superfamily: SSF47396
IPR009083
92-134 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

LAMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALENQVK

BlastProDom: PD009224
IPR015872
92-130 Q7FPX2_ORYSA_Q7FPX2;
Transcription initiation factor IIA, gamma subunit

LAMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALE

HMMPfam: PF02268
IPR015872
92-130 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

LAMCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALE

HMMPanther: PTHR10966
IPR003194
94-186 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MCLTETLDEMVSSGTLSPELAIQVLVQFDKSMTEALENQVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSKLLSQ

superfamily: SSF50784
IPR009088
132-182 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSK

HMMPfam: PF02751
IPR015871
132-181 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDS

Gene3D: G3DSA:2.30.18.10
IPR009088
135-184 no description
Transcription factor IIA, beta-barrel

SKVSIKGHLHTYRFCDNVWTFILTEASFKNEETTEQVGKVKIVACDSKLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox